SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g21250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g21250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g21250

Feature Type:gene_model
Chromosome:Gm13
Start:24749985
stop:24752069
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G31930AT Annotation by Michelle Graham. TAIR10: extra-large GTP-binding protein 3 | chr1:11465832-11468961 FORWARD LENGTH=848 SoyBaseE_val: 1.00E-33ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007186GO-bp Annotation by Michelle Graham. GO Biological Process: G-protein coupled receptor signaling pathway SoyBaseN/AISS
GO:0007188GO-bp Annotation by Michelle Graham. GO Biological Process: adenylate cyclase-modulating G-protein coupled receptor signaling pathway SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009652GO-bp Annotation by Michelle Graham. GO Biological Process: thigmotropism SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0010555GO-bp Annotation by Michelle Graham. GO Biological Process: response to mannitol stimulus SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:2000067GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of root morphogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0031234GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to internal side of plasma membrane SoyBaseN/AISS
GO:0001664GO-mf Annotation by Michelle Graham. GO Molecular Function: G-protein coupled receptor binding SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0019001GO-mf Annotation by Michelle Graham. GO Molecular Function: guanyl nucleotide binding SoyBaseN/AISS
GO:0031683GO-mf Annotation by Michelle Graham. GO Molecular Function: G-protein beta/gamma-subunit complex binding SoyBaseN/AISS
PTHR10218Panther GTP-BINDING PROTEIN ALPHA SUBUNIT JGI ISS
PTHR10218:SF90Panther XLG (EXTRA-LARGE GTP-BINDING PROTEIN) JGI ISS
PF00503PFAM G-protein alpha subunit JGI ISS
UniRef100_G7K9K2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Guanine nucleotide-binding protein alpha-2 subunit n=1 Tax=Medicago truncatula RepID=G7K9K2_MEDTR SoyBaseE_val: 1.00E-34ISS
UniRef100_I1J4M8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J4M8_SOYBN SoyBaseE_val: 4.00E-42ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g21250 not represented in the dataset

Glyma13g21250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g21250.1   sequence type=CDS   gene model=Glyma13g21250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCCTCAACAAGATTCGTATGTGCCTTATTCTCTTTGCCCTTTCCCGATGGTCAGCCTCATGGGCAAAAGGATCAAACTAGTCACTATACCACAGTTCCTAATTATCTGGAACAAAAAAAGACTCAGAAGCTTCTTCTTCTTGGAATTCAAGGATCTGGTACTAGCACTATATTTAAGCAGGCCAAGTTTTTGTATGGGAACAGATTTTCTGATGAAGAGCTTCAGGATCTCCTTGACATTATAGCCATGGGGGATTTAGATGCCTTCTTCCCTGCAGCCACATGGGAATGTGCACCATTAGTTGAAGAAGTATGGAGGGACCTTGCAATACAAGAAACCTTCAAAAGAAAAGATGAGCTTCACTTTCTTCCAGATGTTGTTGAGTACTTAAGTCGG

>Glyma13g21250.1   sequence type=predicted peptide   gene model=Glyma13g21250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ASTRFVCALFSLPFPDGQPHGQKDQTSHYTTVPNYLEQKKTQKLLLLGIQGSGTSTIFKQAKFLYGNRFSDEELQDLLDIIAMGDLDAFFPAATWECAPLVEEVWRDLAIQETFKRKDELHFLPDVVEYLSR







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo