Glyma13g21211 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g21211): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g21211): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g21211

Feature Type:	gene_model
Chromosome:	Gm13
Start:	24710507
stop:	24714700
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g21211

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G10060	AT	Annotation by Michelle Graham. TAIR10: FKBP-like peptidyl-prolyl cis-trans isomerase family protein \| chr3:3102291-3103801 FORWARD LENGTH=230	SoyBase	E_val: 2.00E-104	ISS
GO:0000413	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein peptidyl-prolyl isomerization	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0018208	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0003755	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity	SoyBase	N/A	ISS
GO:0005528	GO-mf	Annotation by Michelle Graham. GO Molecular Function: FK506 binding	SoyBase	N/A	ISS
KOG0544	KOG	FKBP-type peptidyl-prolyl cis-trans isomerase	JGI		ISS
PTHR10516	Panther	FK506 BINDING PROTEIN	JGI		ISS
PF00254	PFAM	FKBP-type peptidyl-prolyl cis-trans isomerase	JGI		ISS
UniRef100_I1L950	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=2 Tax=Glycine max RepID=I1L950_SOYBN	SoyBase	E_val: 8.00E-118	ISS
UniRef100_UPI000233AF52	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AF52 related cluster n=1 Tax=unknown RepID=UPI000233AF52	SoyBase	E_val: 3.00E-120	ISS

Expression Patterns of Glyma13g21211

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g21211 not represented in the dataset	Glyma13g21211 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g21211

Paralog	Evidence	Comments
Glyma10g07290	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g21211 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g148400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g21211

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g21211

Limit To All Plant Sequences

>Glyma13g21211.1   sequence type=CDS   gene model=Glyma13g21211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGAAGGAAGGAGAGCATTACTCAGTTGTCTCCTCACAACTGTTGCTGGAGTCTATGCATGTGATGTGGCTGGAGCTGTTAGCACAAGTAGAAGAGCTCTAAGAGGAGCCAAAATTCCTGAAAGTGATTATACAACCTTGCCCAATGGTTTGAAGTACTATGATTTGAAGGTTGGGAATGGAGCTGAAGCTAAAATGGGATCCCGTGTTGCAATTCATTATGTCGCCAAATGGAAGGGTATCACCTTTATGACTAGTAGACAAGGAATGGGCGTTGGAGGAGGAACGCCCTATGGATTTGATGTAGGCCAATCTGAGAGAGGAACAGTCCTTAAAGGGTTGGATTTAGGAGTACAAGGCATGCGAGTAGGAGGCCAGCGGCTGTTAATTGTTCCTCCTGAACTTGCCTATGGAAGCAAAGGAGTCCAAGAAATCCCTCCCAATTCAACAATAGAGTTGGACATTGAATTGCTTTCTATCAAACAAAGTCCATTCGGGACTCCCGTAAAGATAGTTGAAGGTTAA

Predicted protein sequences of Glyma13g21211

Limit To All Plant Sequences

>Glyma13g21211.1   sequence type=predicted peptide   gene model=Glyma13g21211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YEGRRALLSCLLTTVAGVYACDVAGAVSTSRRALRGAKIPESDYTTLPNGLKYYDLKVGNGAEAKMGSRVAIHYVAKWKGITFMTSRQGMGVGGGTPYGFDVGQSERGTVLKGLDLGVQGMRVGGQRLLIVPPELAYGSKGVQEIPPNSTIELDIELLSIKQSPFGTPVKIVEG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain