SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g20990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g20990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g20990

Feature Type:gene_model
Chromosome:Gm13
Start:24489588
stop:24492480
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53180AT Annotation by Michelle Graham. TAIR10: glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases | chr3:19707068-19711188 FORWARD LENGTH=852 SoyBaseE_val: 2.00E-48ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006542GO-bp Annotation by Michelle Graham. GO Biological Process: glutamine biosynthetic process SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0006807GO-bp Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009399GO-bp Annotation by Michelle Graham. GO Biological Process: nitrogen fixation SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0048829GO-bp Annotation by Michelle Graham. GO Biological Process: root cap development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004356GO-mf Annotation by Michelle Graham. GO Molecular Function: glutamate-ammonia ligase activity SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
GO:0043015GO-mf Annotation by Michelle Graham. GO Molecular Function: gamma-tubulin binding SoyBaseN/AISS
GO:0043621GO-mf Annotation by Michelle Graham. GO Molecular Function: protein self-association SoyBaseN/AISS
PTHR20852Panther GLUTAMINE SYNTHETASE JGI ISS
PTHR20852:SF8Panther NODULIN / GLUTAMATE-AMMONIA LIGASE-LIKE PROTEIN JGI ISS
UniRef100_Q8S4Q4UniRef Annotation by Michelle Graham. Best UniRef hit: Nodulin 6l n=2 Tax=Glycine max RepID=Q8S4Q4_SOYBN SoyBaseE_val: 2.00E-94ISS
UniRef100_Q8S4Q4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nodulin 6l n=2 Tax=Glycine max RepID=Q8S4Q4_SOYBN SoyBaseE_val: 2.00E-94ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g20990 not represented in the dataset

Glyma13g20990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g06810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g20990.1   sequence type=CDS   gene model=Glyma13g20990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATCAGAGAAGCTTGAGAGATGTTGTTGAGCTATACGGAACCGAGGTATCTTTGCAAGGTGTAGAAGAATACCGTAAAGCGTCCGGAATAGAATCCATCAGTTCAACATGCCTCAAAGCTGCAAAATTCTCCGCTATACTCATTAATGATGGCATAGAAATGGACAAAAGGCATGACATACAATGGCACAAGAATTTTACACCTTTTGCTAAAGAGATCCATGCTTTGAAAAGCATAGCTGCATATTACGGTGGTTTAGAAATCAATTTAAATGTGACTAAAACGGATGCTGAGGAGAATCTGAAAGAGGTGTTAACAAATGAGATACATCATCACCATGATATTCTAATTGATTATACCTCTTACTTTTACTTAACACTCAATTTTGCTGTTTACCTTGATTTTGGGTTGGCAATTCCAAAGCTTAGTGTACATGGGATGACTTCTGCAGTTAAAGATCTACTAAATCTGGCTCCAATAAATAAGTTATGCATAGGATTTGAACTCTCTAATCTCCATATACCAGTTGAATTGGCAAGTCTCAAATGCATGTCTAATTTTGAAAGTGATGCTTATACATTTCCTGAAACCTTCTACTTAGGTGCGAAGAATTCTCGCGAAGTTGTTTTCTCTGTTCTGCATGATGCATGCACTGATGGTGAGCTCTCAATTCCTGAGGCTGTGGAAGCTGCAAAAGACATCCTTGCACGAAATGCAATCCGCTTCTATAAGATTAGTTCAACCAACATCACTGCCCCT

>Glyma13g20990.1   sequence type=predicted peptide   gene model=Glyma13g20990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YQRSLRDVVELYGTEVSLQGVEEYRKASGIESISSTCLKAAKFSAILINDGIEMDKRHDIQWHKNFTPFAKEIHALKSIAAYYGGLEINLNVTKTDAEENLKEVLTNEIHHHHDILIDYTSYFYLTLNFAVYLDFGLAIPKLSVHGMTSAVKDLLNLAPINKLCIGFELSNLHIPVELASLKCMSNFESDAYTFPETFYLGAKNSREVVFSVLHDACTDGELSIPEAVEAAKDILARNAIRFYKISSTNITAP







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo