Glyma13g20685 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g20685

Feature Type:	gene_model
Chromosome:	Gm13
Start:	24170823
stop:	24170999
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g20685

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36985	AT	Annotation by Michelle Graham. TAIR10: DVL family protein \| chr2:15534943-15535104 REVERSE LENGTH=53	SoyBase	E_val: 3.00E-19	ISS
GO:0042127	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF08137	PFAM	DVL family	JGI		ISS
UniRef100_I1LZ83	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LZ83_SOYBN	SoyBase	E_val: 3.00E-24	ISS
UniRef100_Q6IM93	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DVL8 n=1 Tax=Arabidopsis thaliana RepID=Q6IM93_ARATH	SoyBase	E_val: 6.00E-10	ISS

Expression Patterns of Glyma13g20685

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g20685 not represented in the dataset	Glyma13g20685 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g20685

Paralog	Evidence	Comments
Glyma10g06491	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g20685 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g143700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g20685

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g20685

Limit To All Plant Sequences

>Glyma13g20685.1   sequence type=CDS   gene model=Glyma13g20685   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGCAGGAAAGCAACACAAGCCAAAGCAATCATCAGCAGCAGCAGCATCAAAATTGTGATCCCTGCAAGTCTTTTGGTCAGAAGTGCAGCCAACTGGTGAAGAAGCAGCGAGCGAAATTCTACATTCTTCGCCGTTGTGTAGCCATGCTTCTGTGTTGGCATGAGCACTGA

Predicted protein sequences of Glyma13g20685

Limit To All Plant Sequences

>Glyma13g20685.1   sequence type=predicted peptide   gene model=Glyma13g20685   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVQESNTSQSNHQQQQHQNCDPCKSFGQKCSQLVKKQRAKFYILRRCVAMLLCWHEH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain