Report for Sequence Feature Glyma13g20670
Feature Type: gene_model
Chromosome: Gm13
Start: 24136433
stop: 24140997
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g20670
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G03345 AT
Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Magnesium transporter (InterPro:IPR018937); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:814196-815478 FORWARD LENGTH=104
SoyBase E_val: 2.00E-50 ISS
GO:0006661 GO-bp
Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR21181 Panther
FAMILY NOT NAMED
JGI ISS
PTHR21181:SF6 Panther
gb def: Hypothetical protein
JGI ISS
PF10270 PFAM
Membrane magnesium transporter
JGI ISS
UniRef100_C6SV70 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SV70_SOYBN
SoyBase E_val: 2.00E-70 ISS
UniRef100_Q2HIM5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Membrane magnesium transporter n=1 Tax=Arabidopsis thaliana RepID=MMGT_ARATH
SoyBase E_val: 7.00E-48 ISS
Expression Patterns of Glyma13g20670
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g20670
Paralog Evidence Comments
Glyma10g06470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g20670 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g143500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g20670
Coding sequences of Glyma13g20670
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g20670.1 sequence type=CDS gene model=Glyma13g20670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTTTAGGTTTTGTTGTCGGATTCCTCGGGCTTCTCATTCTATTTCATGCCGCATATTCCACCATCCAATACAGGGGTTTGTTGAAGATTACGGAGGAAGAGTTTTCAGGGCCTCCTTTGAATGTGGTGATTGAGGTGACTCTAGGGTTAGTTCTTTGCATGTGGGCTGCACTAACCGTGCCAGGGAAATTTTTGTCCATCCACCCTCACTCTGAAGAGAACAGGATTGTTTCTTTACCTTCCAACCTGGACTTCATGATCTTCAACCATCGATACAAAGTCTTTCCTGTGGAAATGGATGTGAAGCTGAAGCATTGA
Predicted protein sequences of Glyma13g20670
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g20670.1 sequence type=predicted peptide gene model=Glyma13g20670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGLGFVVGFLGLLILFHAAYSTIQYRGLLKITEEEFSGPPLNVVIEVTLGLVLCMWAALTVPGKFLSIHPHSEENRIVSLPSNLDFMIFNHRYKVFPVEMDVKLKH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
