Report for Sequence Feature Glyma13g20650
Feature Type: gene_model
Chromosome: Gm13
Start: 24121586
stop: 24123421
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g20650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G09860 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 34 Blast hits to 34 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3026140-3027000 FORWARD LENGTH=98
SoyBase E_val: 8.00E-45 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1LZ78 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZ78_SOYBN
SoyBase E_val: 3.00E-61 ISS
UniRef100_Q9SF88 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: F8A24.9 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SF88_ARATH
SoyBase E_val: 1.00E-25 ISS
Expression Patterns of Glyma13g20650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g20650
Paralog Evidence Comments
Glyma10g06450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g20650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g143300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g20650
Coding sequences of Glyma13g20650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g20650.1 sequence type=CDS gene model=Glyma13g20650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAAGTATTTCGGAAACGCTTATCGTGGCGACCCGGGCGTGCCCCATTCGGACCCGGATCGCTTCGTCAACATATGGGTCGGATCCGCTGCCTTCGCTGTTCTCACATATTTCAATCCCTACATGTGGCAGCTCTCTAATCAGTTCAATTGGCATGACAAAGCAATGTTATATGAGCAATATCACTGGAAACAGGCAAGGAAGAAGAATCAGCCATATGAGTTCTTGTGGACCAAGACCTGGGACAAGAACCACCGGGAACATTACTAA
Predicted protein sequences of Glyma13g20650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g20650.1 sequence type=predicted peptide gene model=Glyma13g20650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEKYFGNAYRGDPGVPHSDPDRFVNIWVGSAAFAVLTYFNPYMWQLSNQFNWHDKAMLYEQYHWKQARKKNQPYEFLWTKTWDKNHREHY*