SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g20431

Feature Type:gene_model
Chromosome:Gm13
Start:23902091
stop:23905135
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g20431
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03460AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:864391-865509 FORWARD LENGTH=89 SoyBaseE_val: 5.00E-19ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T5W8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T5W8_SOYBN SoyBaseE_val: 5.00E-50ISS
UniRef100_Q5YJQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: F12E4.230-like protein (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q5YJQ6_HYAOR SoyBaseE_val: 4.00E-18ISS

Expression Patterns of Glyma13g20431
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g20431 not represented in the dataset
Glyma13g20431 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g20431
ParalogEvidenceComments
Glyma10g06130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g20431 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g20431
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g20431
>Glyma13g20431.1   sequence type=CDS   gene model=Glyma13g20431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCGTTCATCCCAAAATGGTATGGCAGTACTGTTATCTACAATTCTCTCGTTCTTTTTCTGCTATCAATTCTTCGTTTTCGTTTAATTTTCAAACAAAAATTGAATGATGTGATATTACAGGTTTGCTTGGCTTGTTTGCTGCCCCTTTTTCTGGTTCCGATCGTCAACATCCTCCCTCTTCTATACTATTTTATAATGGGAAAAATCTATCGGGTTTTTGGTTGGGAGTACAGGAAACCGGAGAGGGCTCCTCCTGTATGTCCATACAAGCCTCCAACCAACAGGGTTAGTAAAGTTGAGGCAGATGTTGAACCTGTTCCAGCAGATCCTGTTAAGCCTGGAAGTGTAGATGTCAAGCAGGATTAA
Predicted protein sequences of Glyma13g20431
>Glyma13g20431.1   sequence type=predicted peptide   gene model=Glyma13g20431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SFIPKWYGSTVIYNSLVLFLLSILRFRLIFKQKLNDVILQVCLACLLPLFLVPIVNILPLLYYFIMGKIYRVFGWEYRKPERAPPVCPYKPPTNRVSKVEADVEPVPADPVKPGSVDVKQD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo