SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g20180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g20180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g20180

Feature Type:gene_model
Chromosome:Gm13
Start:23623604
stop:23626773
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45490AT Annotation by Michelle Graham. TAIR10: ataurora3 | chr2:18747658-18749044 REVERSE LENGTH=288 SoyBaseE_val: 1.00E-170ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0043987GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-S10 phosphorylation SoyBaseN/AISS
GO:0043988GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-S28 phosphorylation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0000775GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chromosome, centromeric region SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005819GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spindle SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0035175GO-mf Annotation by Michelle Graham. GO Molecular Function: histone kinase activity (H3-S10 specific) SoyBaseN/AISS
GO:0044022GO-mf Annotation by Michelle Graham. GO Molecular Function: histone kinase activity (H3-S28 specific) SoyBaseN/AISS
KOG0580 KOG Serine/threonine protein kinase JGI ISS
PTHR24350Panther SERINE/THREONINE-PROTEIN KINASE IAL-RELATED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_I1LZ26UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZ26_SOYBN SoyBaseE_val: 0ISS
UniRef100_O64629UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein kinase Aurora-3 n=1 Tax=Arabidopsis thaliana RepID=AUR3_ARATH SoyBaseE_val: 5.00E-168ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g20180 not represented in the dataset

Glyma13g20180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g138400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g20180.1   sequence type=CDS   gene model=Glyma13g20180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACGACGTCGTTTTAAGAAAAATAAAAAAATAAGTGTGCTTTACCCAAATTCAAATTCTGAGAAAAACTCCAACGAACTTCGCATTTCCACGAAAATGGCTTCCCAAAACCCAGCGGAGGAAGAAAATTCAAAGCGACATTGGTCCCTTGAAGACTTCGAGATCGGAAAACCTCTCGGTAGGGGCAAATTCGGTAGAGTTTACGTCGCCAGAGAAGTTAAGAGCAAATTTGTTGTGGCGTTGAAGGTTATATTTAAGGAACAAATTGATAAGTACAGAGTTCATCACCAACTGAGGAGAGAGATGGAGATACAGACCAGTCTCCGGCACGCAAACATCCTGCGTCTTTACGGTTGGTTTCATGATGCTGACCGTGTTTTCTTGATTCTTGAGTATGCTCATAAGGGAGAGCTTTACAAGGAGCTGAGAAAAAAGGGTCATCTCACTGAGAAGCAAGCTGCCACGTATATTTTGAGCCTCACAAAGGCGTTGGCATATTGTCATGAGAAACATGTTATTCATAGGGATATCAAGCCAGAAAATTTGTTGCTTGACCATGAGGGGCGTCTTAAAATTGCAGACTTTGGTTGGTCTGTTCAGTCTAGAAGCAAAAGACATACCATGTGTGGAACATTGGATTATTTAGCACCAGAAATGGTTGAAAACAAAGCTCATGACTATGCAGTTGACAACTGGACTTTGGGTATCCTTTGTTATGAGTTCCTCTATGGTGCTCCTCCATTTGAGGCTGAGAGTCAATCTGATACCTTCAAAAGGATAATGAAGGTTGATCTAAGCTTCCCTTCCACCCCTTCTGTCTCTATAGAGGCGAAAAATCTGATTAGTCGGCTCCTGGTGAAAGACTCCTCACGAAGGCTCTCTCTTCAGAAGATAATGGAGCATCCTTGGATAATCAAGAATGCAGATTTTGTGGGTATTTGCTAG

>Glyma13g20180.1   sequence type=predicted peptide   gene model=Glyma13g20180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRRRFKKNKKISVLYPNSNSEKNSNELRISTKMASQNPAEEENSKRHWSLEDFEIGKPLGRGKFGRVYVAREVKSKFVVALKVIFKEQIDKYRVHHQLRREMEIQTSLRHANILRLYGWFHDADRVFLILEYAHKGELYKELRKKGHLTEKQAATYILSLTKALAYCHEKHVIHRDIKPENLLLDHEGRLKIADFGWSVQSRSKRHTMCGTLDYLAPEMVENKAHDYAVDNWTLGILCYEFLYGAPPFEAESQSDTFKRIMKVDLSFPSTPSVSIEAKNLISRLLVKDSSRRLSLQKIMEHPWIIKNADFVGIC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo