SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g19880

Feature Type:gene_model
Chromosome:Gm13
Start:23369958
stop:23373138
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g19880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37250AT Annotation by Michelle Graham. TAIR10: adenosine kinase | chr2:15641991-15643318 FORWARD LENGTH=284 SoyBaseE_val: 8.00E-135ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0046939GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide phosphorylation SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0004017GO-mf Annotation by Michelle Graham. GO Molecular Function: adenylate kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016776GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, phosphate group as acceptor SoyBaseN/AISS
GO:0019205GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity SoyBaseN/AISS
KOG3078 KOG Adenylate kinase JGI ISS
PTHR23359Panther ADENYLATE KINASE JGI ISS
PF00406PFAM Adenylate kinase JGI ISS
UniRef100_I1LYZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Adenylate kinase 14 n=1 Tax=Glycine max RepID=I1LYZ7_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1LYZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase 14 n=1 Tax=Glycine max RepID=I1LYZ7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma13g19880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g19880
ParalogEvidenceComments
Glyma10g05530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g19880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g136000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g19880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g19880
>Glyma13g19880.1   sequence type=CDS   gene model=Glyma13g19880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCCATAACCCGCCTCGCGAAGCGCGCGTTCGTCGTCTCTTCCCTGGCGAGGAGGTGCCTGAGCTCCTCCGTAGTCAACTGCCACGCGCCGCCGCACGACGCCACGTCGTTCCGCCCGTTTCCGCTGCGTGAAGATTCGAGCAAGCGGTGCGTGCAGTGGGTGTTCCTCGGCTGCCCCGGCGTCGGAAAAGGAACGTACGCTAGTCGCCTCTCGAACCTCCTCGGCGTCCCTCACATCGCCACCGGCGATCTCGTTCGCGACGAACTCACCTCCTCTGGCCCCCTTTCTTCCCAGCTATCAGAAATTGTAAAACAAGGTCAATTGGTGTCAGATGAAATTATTATTAGTTTATTGTCAAAGAGACTTGTTGCCGGGGAAGCTAAAGGCGATTTGGGATTTATTCTTGATGGTTTTCCTCGAACAATTAAGCAAGCAGAAATATTGGAAGGGGTAACTGACATTGACTTGGTAATCAATCTGAAGCTTCGAGAAGATGTTCTGCTTGAGAAATGCCTTGGTAGGAGAATTTGCAATCAGTGTGGGGGAAATTTTAATGTTGCTTCCATCAACATCAAGGCTGAGAATGGGAGCCCTGGAATTATTATGGCTCCACTTCTTCCTCCTGAGAATTGTATATCAAAGCTCATTACTCGATCAGATGATACTGAAGCAGTGGTCAAAGAAAGGCTTCGAATATACAATGAAATGACTCAGCCTGTGGAGGAATTTTACCGTTCAAGAGGAAAATTATTGGAGTTTAACCTGCCTGGAGGAATCCCGGAGTCTTGGCCTAAGTTGCTACATGCTCTTAATCTTGATGATTATGAGGACAAACGATCTGCTGCAGCATAA
Predicted protein sequences of Glyma13g19880
>Glyma13g19880.1   sequence type=predicted peptide   gene model=Glyma13g19880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAITRLAKRAFVVSSLARRCLSSSVVNCHAPPHDATSFRPFPLREDSSKRCVQWVFLGCPGVGKGTYASRLSNLLGVPHIATGDLVRDELTSSGPLSSQLSEIVKQGQLVSDEIIISLLSKRLVAGEAKGDLGFILDGFPRTIKQAEILEGVTDIDLVINLKLREDVLLEKCLGRRICNQCGGNFNVASINIKAENGSPGIIMAPLLPPENCISKLITRSDDTEAVVKERLRIYNEMTQPVEEFYRSRGKLLEFNLPGGIPESWPKLLHALNLDDYEDKRSAAA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo