Glyma13g19821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g19821

Feature Type:	gene_model
Chromosome:	Gm13
Start:	23299214
stop:	23304969
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g19821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G12130	AT	Annotation by Michelle Graham. TAIR10: integral membrane TerC family protein \| chr5:3919613-3922154 FORWARD LENGTH=384	SoyBase	E_val: 7.00E-80	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0034660	GO-bp	Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
PF03741	PFAM	Integral membrane protein TerC family	JGI		ISS
UniRef100_B9SGT7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein alx, putative n=1 Tax=Ricinus communis RepID=B9SGT7_RICCO	SoyBase	E_val: 9.00E-91	ISS
UniRef100_UPI000233AC47	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AC47 related cluster n=1 Tax=unknown RepID=UPI000233AC47	SoyBase	E_val: 5.00E-175	ISS

Expression Patterns of Glyma13g19821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g19821 not represented in the dataset	Glyma13g19821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g19821

Paralog	Evidence	Comments
Glyma10g05470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g19821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g19821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g19821

Limit To All Plant Sequences

>Glyma13g19821.1   sequence type=CDS   gene model=Glyma13g19821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTGGCCTCTGTTGTTCACATTCACGCTCCTCCTTTCAGATGCTCTGTACTTCACCACCCCATCTCTTCCTTTTGCTCAGTGTACCATTATCGTCCTCCTCGCCGTTTCCCACTTCTGTGCTCCAGACGAATTGGCCATGACAATTATGCCTCAGAAGTAAAGAGGATCAGTGCTCAACAAAATGATGACATAGGCAAAGTTGAGAAATCTCCCACTCAGGAATCTCTGGGAAATGAGGGTTACAATTCTTCCGTCAGAACTGTAGCCTTATGGGTGTGCACTGCAGTGGCATTTGGTGTTGGTTTGGGTTTTAAGGAAGGTTTTGACAAGGCATCCGAATTCTTTGCTGGGTATATATTGGAGCAAAGTCTTTCTGTAGATAATCTCTTTGTATTTGTTCTAATATTCAATTACTTCAAAGTGCCAGTTACATATCAGAATCGTGTGCTTTCCTATGGTATTGCCGGTGCAGTTGTATTTCGCCTGACAATAATACTTATTGGAACAGCCACCCTGCAGAGGTTTGAGGCAGTCAACCTTCTCTTGGCTGCGATATTACTCTACTCGTCATCTAAGCTATTTGCCAGTGAAGAAGATGAATCTGACTTATCTGATAACTTTGTGGTGAAGACATGTCAGAAATTTATCCCTGTAACAACGTATTATGATGGAAATCGATTCATAACAAATCTTGATGGGGTGTGGAAGGGATCAAACATTTTGGGCAGGCCACCCCTTTGCTTCTTACTGTAG

Predicted protein sequences of Glyma13g19821

Limit To All Plant Sequences

>Glyma13g19821.1   sequence type=predicted peptide   gene model=Glyma13g19821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLASVVHIHAPPFRCSVLHHPISSFCSVYHYRPPRRFPLLCSRRIGHDNYASEVKRISAQQNDDIGKVEKSPTQESLGNEGYNSSVRTVALWVCTAVAFGVGLGFKEGFDKASEFFAGYILEQSLSVDNLFVFVLIFNYFKVPVTYQNRVLSYGIAGAVVFRLTIILIGTATLQRFEAVNLLLAAILLYSSSKLFASEEDESDLSDNFVVKTCQKFIPVTTYYDGNRFITNLDGVWKGSNILGRPPLCFLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain