Glyma13g19570 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g19570

Feature Type:	gene_model
Chromosome:	Gm13
Start:	23049070
stop:	23050138
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g19570

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G53600	AT	Annotation by Michelle Graham. TAIR10: C2H2-type zinc finger family protein \| chr3:19875532-19876059 FORWARD LENGTH=175	SoyBase	E_val: 2.00E-41	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR26374	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR26374:SF459	Panther		JGI		ISS
UniRef100_G7L0M5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Medicago truncatula RepID=G7L0M5_MEDTR	SoyBase	E_val: 7.00E-67	ISS
UniRef100_I1LYW2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LYW2_SOYBN	SoyBase	E_val: 4.00E-128	ISS

Expression Patterns of Glyma13g19570

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g19570

Paralog	Evidence	Comments
Glyma10g05210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g19570 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g133100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g19570

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g19570

Limit To All Plant Sequences

>Glyma13g19570.1   sequence type=CDS   gene model=Glyma13g19570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGCCATTCTGAAGAGACAAAGAGAAACCGAAGCCGAGGAGAGCATCATAAGACTGGCAGAAAGTCTCATGCAACTGTCGCGAGTCCAACAAAAAAGCAAGCCTCTTCTCAAAACCTTTTCTCCAACGGAGTTCGAGTGCAAAACCTGTAACCGCAAGTTTCCATCTTTTCAAGCCCTTGGTGGTCACAGGGCGAGCCACAAGAAGCCCAAGTTCGAAGGTGAAGAACTCAAAGAGGAGGCCAAGAAGGGTCTGAGTTTGGGGAACAAACCCAAAATGCACGAGTGTTCCATTTGCGGCATGGAATTCTCTCTGGGTCAGGCACTGGGGGGTCACATGAGAAAACACAGGGGTGCCACCAGTGAGAATAATAACGAAGCGTTTTCTTCTTCTATAAAGCAAGCAATTTCAAAAGTTCCAGTTTTGAAACGATCGAATAGCAAGAGGGTCATGTGCTTGGAGATGGACCTGAATTTAACGCCTTTGGAAAATGACTTGAAGTTGTTGTTCGGAAACAAGGCTCCTAGAGTCGATCTTTCTTTGTAG

Predicted protein sequences of Glyma13g19570

Limit To All Plant Sequences

>Glyma13g19570.1   sequence type=predicted peptide   gene model=Glyma13g19570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAILKRQRETEAEESIIRLAESLMQLSRVQQKSKPLLKTFSPTEFECKTCNRKFPSFQALGGHRASHKKPKFEGEELKEEAKKGLSLGNKPKMHECSICGMEFSLGQALGGHMRKHRGATSENNNEAFSSSIKQAISKVPVLKRSNSKRVMCLEMDLNLTPLENDLKLLFGNKAPRVDLSL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain