|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00170 | AT | Annotation by Michelle Graham. TAIR10: DNA-directed RNA polymerase family protein | chrC:15938-20068 REVERSE LENGTH=1376 | SoyBase | E_val: 6.00E-29 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006351 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0009295 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleoid | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0003899 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity | SoyBase | N/A | ISS |
UniRef100_Q8HVY3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: DNA-directed RNA polymerase subunit beta'' n=1 Tax=Glycine max RepID=RPOC2_SOYBN | SoyBase | E_val: 4.00E-50 | ISS |
UniRef100_Q8HVY3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase subunit beta'' n=1 Tax=Glycine max RepID=RPOC2_SOYBN | SoyBase | E_val: 4.00E-50 | ISS |
Glyma13g19555 not represented in the dataset |
Glyma13g19555 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.13g132900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g19555.1 sequence type=CDS gene model=Glyma13g19555 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CGGAGAAATCGATTAATTATTCCATTTCAATTCCAATCGATTCAAAAACGAGACAAAGAGCTAATGTTAGCTTTCAGTATCTCGATTGAAATACCAATCAATGGTATTTTTCGTAGAAATAGCATTCTTGCTTATTTCGATGATCCTCAATACCGAACACAGAGCTCGGGAATTACTAAATATAGGACTATAGGTATAAATTCCATTTTTAAAAAAGAGGATTTTTTAATTGAGTATCAAGGAGTTAAAGAATCTAAGACAAAATACCAAATTAAAGACAGATGA
>Glyma13g19555.1 sequence type=predicted peptide gene model=Glyma13g19555 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high RRNRLIIPFQFQSIQKRDKELMLAFSISIEIPINGIFRRNSILAYFDDPQYRTQSSGITKYRTIGINSIFKKEDFLIEYQGVKESKTKYQIKDR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||