SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g19430

Feature Type:gene_model
Chromosome:Gm13
Start:22938769
stop:22940769
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g19430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59890AT Annotation by Michelle Graham. TAIR10: actin depolymerizing factor 4 | chr5:24122545-24123596 FORWARD LENGTH=139 SoyBaseE_val: 6.00E-88ISS
GO:0009870GO-bp Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
KOG1735 KOG Actin depolymerizing factor JGI ISS
PTHR11913Panther ACTIN DEPOLYMERIZING FACTOR JGI ISS
PF00241PFAM Cofilin/tropomyosin-type actin-binding protein JGI ISS
UniRef100_B9T4D2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin depolymerizing factor, putative n=1 Tax=Ricinus communis RepID=B9T4D2_RICCO SoyBaseE_val: 5.00E-93ISS
UniRef100_C6SYJ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYJ7_SOYBN SoyBaseE_val: 4.00E-98ISS

Expression Patterns of Glyma13g19430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g19430
ParalogEvidenceComments
Glyma10g05060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g19430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g131700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g19430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g19430
>Glyma13g19430.1   sequence type=CDS   gene model=Glyma13g19430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAACGCAGCATCTGGTATGGCCGTCCATGATGACTGCAAGCTAAAGTTTTTGGAGCTCAAGGCGAAGAGGACGTACCGGTTTATCGTTTTTAAGATTGAGGAGAAGCAGAAGCAAGTTATTGTGGAGAAGCTGGGTGAGCCTGCAAATGGTTATGATGATTTCGCTGCCAGTCTTCCTGCCGACGAGTGTCGATATGCTGTTTATGATTTTGATTTTGTCACTGAAGAGAATTGCCAAAAGAGCAGAATTTTCTTCATTGCTTGGTCCCCTGATACATCTAGGGTTAGGAGCAAGATGATTTATGCCAGCTCCAAAGATAGATTCAAGAGGGAGCTTGATGGGATTCAGATTGAGCTGCAAGCAACTGATCCTACTGAGATGGGTCTTGATGTGTTCAAAAGCCGTGCCAATTAA
Predicted protein sequences of Glyma13g19430
>Glyma13g19430.1   sequence type=predicted peptide   gene model=Glyma13g19430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASLPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIELQATDPTEMGLDVFKSRAN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo