Glyma13g19001 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g19001): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g19001): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g19001

Feature Type:	gene_model
Chromosome:	Gm13
Start:	22600673
stop:	22602470
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g19001

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G43940	AT	Annotation by Michelle Graham. TAIR10: GroES-like zinc-binding dehydrogenase family protein \| chr5:17684265-17686379 FORWARD LENGTH=391	SoyBase	E_val: 2.00E-34	ISS
GO:0006069	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethanol oxidation	SoyBase	N/A	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0008219	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell death	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0046292	GO-bp	Annotation by Michelle Graham. GO Biological Process: formaldehyde metabolic process	SoyBase	N/A	ISS
GO:0048316	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed development	SoyBase	N/A	ISS
GO:0051049	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transport	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0051903	GO-mf	Annotation by Michelle Graham. GO Molecular Function: S-(hydroxymethyl)glutathione dehydrogenase activity	SoyBase	N/A	ISS
GO:0080007	GO-mf	Annotation by Michelle Graham. GO Molecular Function: S-nitrosoglutathione reductase activity	SoyBase	N/A	ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF4	Panther	ARYL-ALCOHOL DEHYDROGENASE	JGI		ISS
PF08240	PFAM	Alcohol dehydrogenase GroES-like domain	JGI		ISS
UniRef100_A2XAZ3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alcohol dehydrogenase class-3 n=2 Tax=Magnoliophyta RepID=ADHX_ORYSI	SoyBase	E_val: 9.00E-35	ISS
UniRef100_UPI000233CBF4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CBF4 related cluster n=1 Tax=unknown RepID=UPI000233CBF4	SoyBase	E_val: 7.00E-47	ISS

Expression Patterns of Glyma13g19001

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g19001 not represented in the dataset	Glyma13g19001 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g19001 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g19001

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g19001

Limit To All Plant Sequences

>Glyma13g19001.1   sequence type=CDS   gene model=Glyma13g19001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCACGATATCTTGTTTGTTTTATTGAATCTGAATTCCATTTGTTGGTGTTCTCGTCTCACTGCCGTACAATTATTCCATTTCATTCCTTCTCGATGGCTACTACTCAAGGACAAGTCATTACATGCAAATTAAAGCCGCGGTGGCCTGGGAACCCAACAAGCCATTGTCCATCGAGGACGTTCAGGTGGCGCCACCGCAGAATGGCGAGGTCCGTATCCAAATTCTCTACACTGCTTTCTGTCACACCGACGCTTACACTTGGAGCGGCAAGATCCAGAAGGTCTTTTCCATGTATACTTGATCATGAGGCTGCAGGGATTGTGGAAAGTGTTGGAGAAGGTGTTACTGCAGTTCAGCCCGGTGATCATGTCATCCCTTGTTACCAGGCTGAGTGTGAAGAGTGCAAGTTTTGCATATTAGGCAAAACCAATCCGTGTGGCAAAGTTCGAGCCGCCACAGGGGTAGGGGTCATGCTGAGCAATCACTAG

Predicted protein sequences of Glyma13g19001

Limit To All Plant Sequences

>Glyma13g19001.1   sequence type=predicted peptide   gene model=Glyma13g19001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SRYLVCFIESEFHLLVFSSHCRTIIPFHSFSMATTQGQVITCKLKPRWPGNPTSHCPSRTFRWRHRRMARSVSKFSTLLSVTPTLTLGAARSRRSFPCILDHEAAGIVESVGEGVTAVQPGDHVIPCYQAECEECKFCILGKTNPCGKVRAATGVGVMLSNH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain