Glyma13g18981 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g18981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g18981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g18981

Feature Type:	gene_model
Chromosome:	Gm13
Start:	22588958
stop:	22590618
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g18981

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G73840	AT	Annotation by Michelle Graham. TAIR10: hydroxyproline-rich glycoprotein family protein \| chr1:27763937-27766328 REVERSE LENGTH=388	SoyBase	E_val: 8.00E-11	ISS
GO:0000398	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome	SoyBase	N/A	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0006470	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation	SoyBase	N/A	ISS
GO:0030422	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in RNA interference	SoyBase	N/A	ISS
GO:0035194	GO-bp	Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing by RNA	SoyBase	N/A	ISS
GO:0035196	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_O81698	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proline-rich protein n=1 Tax=Glycine max RepID=O81698_SOYBN	SoyBase	E_val: 6.00E-46	ISS
UniRef100_UPI000233CBF2	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CBF2 related cluster n=1 Tax=unknown RepID=UPI000233CBF2	SoyBase	E_val: 2.00E-60	ISS

Expression Patterns of Glyma13g18981

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g18981 not represented in the dataset	Glyma13g18981 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g18981

Paralog	Evidence	Comments
Glyma10g04650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g18981 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g127700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g18981

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g18981

Limit To All Plant Sequences

>Glyma13g18981.1   sequence type=CDS   gene model=Glyma13g18981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTTAGGGCCTGAATTTGGCAATCAAGCTGGAAATGCTACACAAGTAGACAGAGGGTCTTCTTTGATGCCCAGTCCCTCAGATAACCTAGCTCATCTTTCTGGTCCTCCTGGATACGTAGTTTCTGCTCAGATGGGTGCTGCTAATCAGCCTCTTCGGCCTCCTGTGTTGACACCAGATATGGAGAAGGCACTGCTTCAACAGGTCACGAGCCTCACCCTGGGGCAGATAAATCTCCTATCACCAGAACAAAGAAATCAAGTGCTGCAGCTACAACAAATGTTGCATCAATGA

Predicted protein sequences of Glyma13g18981

Limit To All Plant Sequences

>Glyma13g18981.1   sequence type=predicted peptide   gene model=Glyma13g18981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPLGPEFGNQAGNATQVDRGSSLMPSPSDNLAHLSGPPGYVVSAQMGAANQPLRPPVLTPDMEKALLQQVTSLTLGQINLLSPEQRNQVLQLQQMLHQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain