SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g18900

Feature Type:gene_model
Chromosome:Gm13
Start:22515070
stop:22515841
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g18900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43970AT Annotation by Michelle Graham. TAIR10: translocase of outer membrane 22-V | chr5:17692888-17693187 FORWARD LENGTH=99 SoyBaseE_val: 2.00E-35ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005742GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane translocase complex SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
PTHR12504Panther MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM22 JGI ISS
UniRef100_I1LYP2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LYP2_SOYBN SoyBaseE_val: 1.00E-61ISS
UniRef100_Q9FNC9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM22 homolog 2 n=1 Tax=Arabidopsis thaliana RepID=TO222_ARATH SoyBaseE_val: 8.00E-33ISS

Expression Patterns of Glyma13g18900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g18900
ParalogEvidenceComments
Glyma10g04590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g18900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g126900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g18900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g18900
>Glyma13g18900.1   sequence type=CDS   gene model=Glyma13g18900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCCGAAGAGGTGGAGTCTCACTCCCAGACAGACCTAGCAACAACTCAAGCTCCGTCCTCGCGAAGATCTCGCGCTCCTCCATCGTCACCCGCGGCAAGGAAGCCGCCGGCGACGCCGCATTCGTCGCCAAGAAGCTCCTCCGCAGCACCGGCAAGGCCGCGTGGATCGCCGGCACCACCTTCCTCGTCCTCGTTGTTCCTCTCATCGTCGAGATGGACCGCGAGCAGCAGCTCAACGACCTCGAGCTCCAGCAGGCCAGCCTCCTCGGCACCCCCGCCCCCAAATAA
Predicted protein sequences of Glyma13g18900
>Glyma13g18900.1   sequence type=predicted peptide   gene model=Glyma13g18900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRRGGVSLPDRPSNNSSSVLAKISRSSIVTRGKEAAGDAAFVAKKLLRSTGKAAWIAGTTFLVLVVPLIVEMDREQQLNDLELQQASLLGTPAPK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo