SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g18350

Feature Type:gene_model
Chromosome:Gm13
Start:22001514
stop:22002176
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g18350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23240AT Annotation by Michelle Graham. TAIR10: ethylene response factor 1 | chr3:8295705-8296361 FORWARD LENGTH=218 SoyBaseE_val: 3.00E-52ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_D8VD37UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene response factor 10 n=1 Tax=Actinidia deliciosa RepID=D8VD37_ACTDE SoyBaseE_val: 1.00E-51ISS
UniRef100_I1LYJ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LYJ4_SOYBN SoyBaseE_val: 1.00E-156ISS

Expression Patterns of Glyma13g18350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g18350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g122700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g18350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g18350
>Glyma13g18350.1   sequence type=CDS   gene model=Glyma13g18350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCCCCCTTTCTTCCAGAACCCAGCTTCAGATTGGAACATGTTGCAGCAGGAGCCTTCAGAAATTTTGTTCGATTCAATGTCAAGCAATAATGCTGTTCTTGACCCTATCCAAGATTCTCTTTCCTTTGATATGGTTGACTTCTCCACAACACCAACAGAAGGAAACCATAACGAGGCAAAGAAATTGGTGGTGAAATCTGAACTGCAGAATAATAAGGAAAGGTCTTACATTGGTGTGAGGAAAAGGCCTTGGGGAAAATTCGCAGCAGAGATCAGAGACACAACGAGGAACGGTGCGAGGGTTTGGCTTGGAACCTTTGACAGTGCTGAGGCTGCTGCATTAGCTTATGACCAAGCTGCATTTACCATGAGAGGTGATAATGCTGTGCTCAATTTTCCGGTGAAGACGGTGAAAGAGTCTTTGCAAGAGATTCAATATAGCTGCAGCAATGGTTCTTCTCCTGCACTTGCACTCAAGGAGAGGCACTGTATCCAAAGAAAGTTGTCATTAAAGGGTAGAAAGTGTAAAGCGAAAGAGACATCATCATCAGAGGATCCAACACCAAGTGTGTTGGTGTTCGAGGACTTGGGAGCTGACTATCTTGAGCAACTTCTAAGCATATCTGATCAAAGTGCAAGACCTAGCTACTTCAGCTAA
Predicted protein sequences of Glyma13g18350
>Glyma13g18350.1   sequence type=predicted peptide   gene model=Glyma13g18350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPPFFQNPASDWNMLQQEPSEILFDSMSSNNAVLDPIQDSLSFDMVDFSTTPTEGNHNEAKKLVVKSELQNNKERSYIGVRKRPWGKFAAEIRDTTRNGARVWLGTFDSAEAAALAYDQAAFTMRGDNAVLNFPVKTVKESLQEIQYSCSNGSSPALALKERHCIQRKLSLKGRKCKAKETSSSEDPTPSVLVFEDLGADYLEQLLSISDQSARPSYFS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo