Glyma13g18120 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g18120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g18120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g18120

Feature Type:	gene_model
Chromosome:	Gm13
Start:	21768153
stop:	21769176
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g18120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38870	AT	Annotation by Michelle Graham. TAIR10: Serine protease inhibitor, potato inhibitor I-type family protein \| chr2:16236546-16237050 REVERSE LENGTH=70	SoyBase	E_val: 5.00E-16	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0004867	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase inhibitor activity	SoyBase	N/A	ISS
PF00280	PFAM	Potato inhibitor I family	JGI		ISS
UniRef100_G7I4R6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Inhibitor of trypsin and hageman factor n=1 Tax=Medicago truncatula RepID=G7I4R6_MEDTR	SoyBase	E_val: 1.00E-19	ISS
UniRef100_I1LYH2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LYH2_SOYBN	SoyBase	E_val: 2.00E-42	ISS

Expression Patterns of Glyma13g18120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g18120 not represented in the dataset	Glyma13g18120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g18120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g120600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g18120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g18120

Limit To All Plant Sequences

>Glyma13g18120.1   sequence type=CDS   gene model=Glyma13g18120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGTCTACTATGTCAAGGGAAGAGTTCGTGGCCTGAGGTTGTGGGAACAAACGGGGTGGTAGCAGTGGAGAAGATTGAGAGAGAGAATGATAATGTTCGTGCAAGATTGGTGGGAGAAGGATCTATGGTGACAATGGACTTTTGGTGCAACCGAGTTTGGGTTTGGGTCGACAAAATTGGGGTGGTCACTCGTGTGCCAAAGATAGGTTAG

Predicted protein sequences of Glyma13g18120

Limit To All Plant Sequences

>Glyma13g18120.1   sequence type=predicted peptide   gene model=Glyma13g18120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLLCQGKSSWPEVVGTNGVVAVEKIERENDNVRARLVGEGSMVTMDFWCNRVWVWVDKIGVVTRVPKIG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain