Glyma13g17901 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g17901): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g17901): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g17901

Feature Type:	gene_model
Chromosome:	Gm13
Start:	21589980
stop:	21592397
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g17901

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16610	AT	Annotation by Michelle Graham. TAIR10: pentatricopeptide (PPR) repeat-containing protein \| chr3:5656371-5658335 REVERSE LENGTH=654	SoyBase	E_val: 1.00E-22	ISS
GO:0006302	GO-bp	Annotation by Michelle Graham. GO Biological Process: double-strand break repair	SoyBase	N/A	ISS
GO:0006312	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitotic recombination	SoyBase	N/A	ISS
GO:0007062	GO-bp	Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion	SoyBase	N/A	ISS
GO:0007129	GO-bp	Annotation by Michelle Graham. GO Biological Process: synapsis	SoyBase	N/A	ISS
GO:0007131	GO-bp	Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0042138	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation	SoyBase	N/A	ISS
GO:0045132	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR24015	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24015:SF175	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF01535	PFAM	PPR repeat	JGI		ISS
UniRef100_D7L652	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L652_ARALL	SoyBase	E_val: 7.00E-21	ISS
UniRef100_I1K368	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K368_SOYBN	SoyBase	E_val: 2.00E-61	ISS

Expression Patterns of Glyma13g17901

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g17901 not represented in the dataset	Glyma13g17901 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g17901 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g118700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g17901

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g17901

Limit To All Plant Sequences

>Glyma13g17901.1   sequence type=CDS   gene model=Glyma13g17901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTCGCGTCCAACGAACACAGTTACTACCGTGATGGGGTGGAGCTGTTTTGCATGATGTTGGACCAAGGCATGTTGCCAGATGGGTTTGCCTTCTCTGCTGTTTTGCAGTTATGTGTGGGGTTGGATTCGGTTGAGTTGGGTGAGATGGTGCATGCCCATGTTGTTGTCACGAGATTTTTTATGCATACAATTGTTGGTACCTCTCTTCTCAACATGTATGCAAAGTTGGGAGAGAATGAGAATTCAGTTAAGGTGTTCAACTCCATGCCAGTGCGTAACATTGTCTCTTGGAATGCAATGATTTCCGGGTTTACCTCTAACACCTACAAGCATTTGATCGAAGCGTGA

Predicted protein sequences of Glyma13g17901

Limit To All Plant Sequences

>Glyma13g17901.1   sequence type=predicted peptide   gene model=Glyma13g17901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVASNEHSYYRDGVELFCMMLDQGMLPDGFAFSAVLQLCVGLDSVELGEMVHAHVVVTRFFMHTIVGTSLLNMYAKLGENENSVKVFNSMPVRNIVSWNAMISGFTSNTYKHLIEA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain