SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g17790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g17790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g17790

Feature Type:gene_model
Chromosome:Gm13
Start:21511117
stop:21514221
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28050AT Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr5:10044209-10045755 REVERSE LENGTH=185 SoyBaseE_val: 7.00E-112ISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0009218GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide metabolic process SoyBaseN/AISS
GO:0019690GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine deoxyribonucleoside interconversion SoyBaseN/AISS
GO:0019692GO-bp Annotation by Michelle Graham. GO Biological Process: deoxyribose phosphate metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG1018 KOG Cytosine deaminase FCY1 and related enzymes JGI ISS
PTHR11079Panther CYTOSINE DEAMINASE JGI ISS
PTHR11079:SF18Panther SUBFAMILY NOT NAMED JGI ISS
PF00383PFAM Cytidine and deoxycytidylate deaminase zinc-binding region JGI ISS
UniRef100_B4FPE0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytidine/deoxycytidylate deaminase family protein n=1 Tax=Zea mays RepID=B4FPE0_MAIZE SoyBaseE_val: 1.00E-118ISS
UniRef100_I1LYE2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LYE2_SOYBN SoyBaseE_val: 3.00E-165ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g17790 not represented in the dataset

Glyma13g17790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g04720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g117500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g17790.1   sequence type=CDS   gene model=Glyma13g17790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATTTATTTATTAATATTTACGTATCGACCATATTCTATTTTTTGGTGGACCGCATTCACCTTCTTCTCCTTCTAACCCAACCTGTTTCTCCGACAATCACATTCAACGCTTCTGTCATGGAAGAAGTTAATGTCGTGGAAACTAAGGATGGAACTGTCTCAGTAGCTGCTGCGTTTGCTGGTCACCAGGAAGCCGTGCAGGATAGAGACCACAAATTTTTAAGCAAAGCTGTTGAAGAAGCATATAAAGGGGTAGATTGTAAAGATGGAGGCCCTTTTGGTGCCGTTATAGTTCATAATGATGAAATAGTTGCTAGTTGTCACAATATGGTTCTGTGTAACACAGACCCAACTGCTCATGCTGAGGTGACAGCAATAAGAGAGGCTTGCAAGAAGCTTAAGCAGATAGAACTTGCTGATTGTGAAATATATGCTTCTTGTGAACCTTGCCCCATGTGCTTTGGTGCAATCCACCTTTCTCGAATTAAGAGGTTGGTTTATGGAGCGAAGGCCGAGGCAGCAATTGCTATTGGGTTTGATGATTTCATTGCCGATGCATTGCGAGGTACTGGATTCTATCAGAAAGCAACATTGGAAATTAAGAGAGCTGATGGTAATGAGGCCATCATTGCTGAAGAGGTTTTTGAGAAAACAAAGGAAAAATTCCAAATGTATTAG

>Glyma13g17790.1   sequence type=predicted peptide   gene model=Glyma13g17790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYLFINIYVSTIFYFLVDRIHLLLLLTQPVSPTITFNASVMEEVNVVETKDGTVSVAAAFAGHQEAVQDRDHKFLSKAVEEAYKGVDCKDGGPFGAVIVHNDEIVASCHNMVLCNTDPTAHAEVTAIREACKKLKQIELADCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGFDDFIADALRGTGFYQKATLEIKRADGNEAIIAEEVFEKTKEKFQMY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo