Glyma13g17385 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g17385): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g17385): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g17385

Feature Type:	gene_model
Chromosome:	Gm13
Start:	21144226
stop:	21146793
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g17385

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G57000	AT	Annotation by Michelle Graham. TAIR10: nucleolar essential protein-related \| chr3:21092610-21094109 FORWARD LENGTH=298	SoyBase	E_val: 2.00E-29	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
PTHR12636	Panther	NEP1	JGI		ISS
PTHR12636:SF2	Panther	UNCHARACTERIZED	JGI		ISS
PF03587	PFAM	EMG1/NEP1 methyltransferase	JGI		ISS
UniRef100_B9SZX7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar essential protein, putative n=1 Tax=Ricinus communis RepID=B9SZX7_RICCO	SoyBase	E_val: 1.00E-34	ISS
UniRef100_I3TAC5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3TAC5_LOTJA	SoyBase	E_val: 4.00E-39	ISS

Expression Patterns of Glyma13g17385

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g17385 not represented in the dataset	Glyma13g17385 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g17385 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g113600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g17385

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g17385

Limit To All Plant Sequences

>Glyma13g17385.1   sequence type=CDS   gene model=Glyma13g17385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGCGGAGTTGCTGCAAAAGTTCAGTATCAAATCAAAAGGTGGTCATGGAAAGCTTTTAAGGTTAATTCAAAACCCTGTGACCGATCACTCACCTATCAACTCCTGCAAAGTAGGTCTTTCTTTTAGCTCACAAAAGACAGTTCAATTAAGGGACTATGTTAGTGATGCTAATTGTAATGAGAACCTTGTATTCGTGGTTGGTGCAATGGCTCATGGAAAAATTGATGCTGACTACATTGATGATCTTATATCAGTTTCAGGTTATCCACTGAGCGCGGGGACTTGTCTTAGGCGGATCTGCATTGCATTAGAGAGAAATTTGAAGATCCAATGA

Predicted protein sequences of Glyma13g17385

Limit To All Plant Sequences

>Glyma13g17385.1   sequence type=predicted peptide   gene model=Glyma13g17385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKAELLQKFSIKSKGGHGKLLRLIQNPVTDHSPINSCKVGLSFSSQKTVQLRDYVSDANCNENLVFVVGAMAHGKIDADYIDDLISVSGYPLSAGTCLRRICIALERNLKIQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain