SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g17380

Feature Type:gene_model
Chromosome:Gm13
Start:21138965
stop:21141170
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g17380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G43120AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr3:15094644-15095312 FORWARD LENGTH=160 SoyBaseE_val: 2.00E-73ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_I1LY99UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LY99_SOYBN SoyBaseE_val: 9.00E-114ISS
UniRef100_Q8H6T6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-regulated protein n=1 Tax=Phaseolus vulgaris RepID=Q8H6T6_PHAVU SoyBaseE_val: 7.00E-95ISS

Expression Patterns of Glyma13g17380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g17380
ParalogEvidenceComments
Glyma17g05120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g17380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g113500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g17380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g17380
>Glyma13g17380.1   sequence type=CDS   gene model=Glyma13g17380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGATGCTGGAGGTTCCAAATTGCATGGAATTAAGCAGATTGTGAGATTGAAGGAAATGTTTCAGAAGTGGCAAACTGTAACTCTGGGCTCAAAAGATTCCAACAATCATTCTGATGTGACTCATCATCATGGGGTCTTATCACCAATGATTAACAAAAGGCTAACTGATATTGTGTATTGTGACTCTGATGAGGATGGCTGCTACAGCCCTCAACCACCACATGATGTTCCCAAAGGGTACTTAGCCGTCTATGTTGGTCCTCAGCTTCGGAGGTTTATCATTCCCACAAGCTACCTTAGCCACTCTTTGTTCAAGGCGTTGCTGGAAAAGGCTGCAGAGGAATTTGGGTTTGATCAGAGTGGTGGACTCACCATTCCATGTGAAATTGAGACCTTTAAATACCTCTTGAATTGCATAGAGAACCATGATGACAGCTCCACTGAAAATACAGGAACTGTGGAAGAATAA
Predicted protein sequences of Glyma13g17380
>Glyma13g17380.1   sequence type=predicted peptide   gene model=Glyma13g17380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDAGGSKLHGIKQIVRLKEMFQKWQTVTLGSKDSNNHSDVTHHHGVLSPMINKRLTDIVYCDSDEDGCYSPQPPHDVPKGYLAVYVGPQLRRFIIPTSYLSHSLFKALLEKAAEEFGFDQSGGLTIPCEIETFKYLLNCIENHDDSSTENTGTVEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo