Glyma13g17180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g17180

Feature Type:	gene_model
Chromosome:	Gm13
Start:	20986184
stop:	20988819
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g17180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G19180	AT	Annotation by Michelle Graham. TAIR10: jasmonate-zim-domain protein 1 \| chr1:6622312-6623271 FORWARD LENGTH=253	SoyBase	E_val: 1.00E-53	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0007154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell communication	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009908	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower development	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF06200	PFAM	tify domain	JGI		ISS
PF09425	PFAM	Divergent CCT motif	JGI		ISS
UniRef100_G7IIQ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein TIFY 10B n=1 Tax=Medicago truncatula RepID=G7IIQ4_MEDTR	SoyBase	E_val: 1.00E-76	ISS
UniRef100_I1LY77	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LY77_SOYBN	SoyBase	E_val: 1.00E-178	ISS

Expression Patterns of Glyma13g17180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g17180

Paralog	Evidence	Comments
Glyma17g05540	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g17180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g112000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g17180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g17180

Limit To All Plant Sequences

>Glyma13g17180.1   sequence type=CDS   gene model=Glyma13g17180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCAGCTCATCGGAATATTTGGTATTTTCCGGCCACCACCCGGCGAACTCTCCGGCGGAAAAGTCCACTTTCTCTCAGACTTGTAGTCTATTGAGCCAATACATCAAGGAAAAGGGTACCTTCGGAGACCTTACCCTCGGGATGACTTGCACTGCCGAAACAAACGGTTCCCCTGAGACATCGTGTCACTCTGCAACAACCATGGAGTTGTTTCCCACGATCATCACGCAACGGAACCCAACTACTGTGGATTTCCTATCTCCCCAGACTGCTTATCCTCACCACTCAGAGGTTCCAATCATGGTTAAATCAAGTGCTTTTAAGTCTATGGAGAAGGAGCCTAAAGCTGCTCAGTTGACGATCTTTTATGCTGGGCAAGTTGTTGTGTTTGATGATTTTCCTGCTGAAAAATTGGAGGAGATAACGTCATTAGCCGGCAAGGGAATATCCCAAAGCCAAAACACCTCTGCTTATGCTCACACTCATAACCAGCAAGTGAATCATCCTTCCTTTGTTCCTAATATCTCCCCTCAAGCACCGTCCAGACCACTTGTTTGTGATCTGCCAATTGCTAGGAAAGCTTCACTTCATCGGTTCCTTTCTAAGAGAAAAGATAGAATTGCTGCCAAAGCACCCTATCAAATAAACAATCCCAACTCTGCTTCAAGTAAGCCGGCTGAATCCATGTCATGGCTTGGATTAGGTGCTCAATCAACACAAGTCTAA

Predicted protein sequences of Glyma13g17180

Limit To All Plant Sequences

>Glyma13g17180.1   sequence type=predicted peptide   gene model=Glyma13g17180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSEYLVFSGHHPANSPAEKSTFSQTCSLLSQYIKEKGTFGDLTLGMTCTAETNGSPETSCHSATTMELFPTIITQRNPTTVDFLSPQTAYPHHSEVPIMVKSSAFKSMEKEPKAAQLTIFYAGQVVVFDDFPAEKLEEITSLAGKGISQSQNTSAYAHTHNQQVNHPSFVPNISPQAPSRPLVCDLPIARKASLHRFLSKRKDRIAAKAPYQINNPNSASSKPAESMSWLGLGAQSTQV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain