|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G05030 | AT | Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein | chr1:1438324-1441385 REVERSE LENGTH=524 | SoyBase | E_val: 1.00E-27 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0005351 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity | SoyBase | N/A | ISS |
| GO:0015144 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0022857 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity | SoyBase | N/A | ISS |
| PTHR24063 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24063:SF84 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00083 | PFAM | Sugar (and other) transporter | JGI | ISS | |
| UniRef100_I1LXW9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1LXW9_SOYBN | SoyBase | E_val: 6.00E-40 | ISS |
| UniRef100_Q67V03 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Hexose transporter-like protein n=1 Tax=Oryza sativa Japonica Group RepID=Q67V03_ORYSJ | SoyBase | E_val: 1.00E-27 | ISS |
|
Glyma13g13791 not represented in the dataset |
Glyma13g13791 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.13g026800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g13791.1 sequence type=CDS gene model=Glyma13g13791 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGGTTCAGTTTTTCTACTCATTGGGTTTGTAATTTTGTGGTGGGATTATTCTTTCTTGAATTGGTGGATAAATTTGGAGTTGCACCTGTATATGCCAGCTTTGGTGCAATTTCCCTGTTAGCCGCAACATTTGCCTATTACTTCATAGTAGAAACTAAGGGACGCTCTCTAGAAGAAATTGAACGATCCTTGAACCTAAAAGCTTAA
>Glyma13g13791.1 sequence type=predicted peptide gene model=Glyma13g13791 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGFSFSTHWVCNFVVGLFFLELVDKFGVAPVYASFGAISLLAATFAYYFIVETKGRSLEEIERSLNLKA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||