SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g12601

Feature Type:gene_model
Chromosome:Gm13
Start:16292719
stop:16296718
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g12601
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01170AT Annotation by Michelle Graham. TAIR10: bidirectional amino acid transporter 1 | chr2:102364-104157 REVERSE LENGTH=437 SoyBaseE_val: 1.00E-59ISS
GO:0003333GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transmembrane transport SoyBaseN/AISS
GO:0015812GO-bp Annotation by Michelle Graham. GO Biological Process: gamma-aminobutyric acid transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005313GO-mf Annotation by Michelle Graham. GO Molecular Function: L-glutamate transmembrane transporter activity SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
GO:0015180GO-mf Annotation by Michelle Graham. GO Molecular Function: L-alanine transmembrane transporter activity SoyBaseN/AISS
GO:0015181GO-mf Annotation by Michelle Graham. GO Molecular Function: arginine transmembrane transporter activity SoyBaseN/AISS
GO:0015185GO-mf Annotation by Michelle Graham. GO Molecular Function: gamma-aminobutyric acid transmembrane transporter activity SoyBaseN/AISS
GO:0015189GO-mf Annotation by Michelle Graham. GO Molecular Function: L-lysine transmembrane transporter activity SoyBaseN/AISS
PTHR11785Panther AMINO ACID TRANSPORTER JGI ISS
PTHR11785:SF13Panther AMINO ACID TRANSPORTER-RELATED JGI ISS
UniRef100_B9HJ66UniRef Annotation by Michelle Graham. Most informative UniRef hit: Amino acid transporter n=1 Tax=Populus trichocarpa RepID=B9HJ66_POPTR SoyBaseE_val: 1.00E-65ISS
UniRef100_UPI000233C46BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C46B related cluster n=1 Tax=unknown RepID=UPI000233C46B SoyBaseE_val: 2.00E-104ISS

Expression Patterns of Glyma13g12601
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g12601 not represented in the dataset
Glyma13g12601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g12601 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g025300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g12601
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g12601
>Glyma13g12601.1   sequence type=CDS   gene model=Glyma13g12601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCCTACACGGTAGAATAAATAGTGTTCCTATCTCAGTGATATCATTCTTAAGACAGTTGGGTGTAATCTGGAATGTTTTAGGCGTTTTTGTTCTTATGATACTCATTCCATCTGTTGCAACGAAAAGGGCTAGTCTAAAGTTTGCTTTCACTCATTTCAATACTAAAAATGAGGATGGAATCAAAAGCAAACCCAACATATTTCTCTTGGGACTACTAATGAGTCAATATACCTTAATTGGGTATGATGCATCAGCTCATATGACAGAGGAAACAAAGGGTGCTGATAGAAATAGACCAAAAGGAATAGCCAGCGAAGTTGGGATATTTATTATAGTTGGATGGGGTTACATACTAGGCATTAGCTTTGCCGTTACTAACATCCCTTACTTTTTGAGGGAAAGTAATGATGCAGGTAGGTATGCCATTGGTGAAATGTTTTATCTGGCTTTCTAG
Predicted protein sequences of Glyma13g12601
>Glyma13g12601.1   sequence type=predicted peptide   gene model=Glyma13g12601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLHGRINSVPISVISFLRQLGVIWNVLGVFVLMILIPSVATKRASLKFAFTHFNTKNEDGIKSKPNIFLLGLLMSQYTLIGYDASAHMTEETKGADRNRPKGIASEVGIFIIVGWGYILGISFAVTNIPYFLRESNDAGRYAIGEMFYLAF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo