Glyma13g12470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g12470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g12470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g12470

Feature Type:	gene_model
Chromosome:	Gm13
Start:	16031907
stop:	16033325
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g12470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18500	AT	Annotation by Michelle Graham. TAIR10: methylthioalkylmalate synthase-like 4 \| chr1:6369347-6372861 FORWARD LENGTH=631	SoyBase	E_val: 4.00E-29	ISS
GO:0009098	GO-bp	Annotation by Michelle Graham. GO Biological Process: leucine biosynthetic process	SoyBase	N/A	ISS
GO:0019752	GO-bp	Annotation by Michelle Graham. GO Biological Process: carboxylic acid metabolic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0003852	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 2-isopropylmalate synthase activity	SoyBase	N/A	ISS
GO:0046912	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer	SoyBase	N/A	ISS
PTHR10277	Panther	ISOPROPYLMALATE SYNTHASE RELATED	JGI		ISS
PTHR10277:SF9	Panther	2-ISOPROPYLMALATE SYNTHASE-RELATED	JGI		ISS
UniRef100_I1LKJ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LKJ2_SOYBN	SoyBase	E_val: 7.00E-41	ISS
UniRef100_Q39891	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Probable 2-isopropylmalate synthase n=1 Tax=Glycine max RepID=LEU1_SOYBN	SoyBase	E_val: 6.00E-39	ISS

Expression Patterns of Glyma13g12470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g12470 not represented in the dataset	Glyma13g12470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g12470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g12470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g12470

Limit To All Plant Sequences

>Glyma13g12470.1   sequence type=CDS   gene model=Glyma13g12470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTTTAAAACGAGTGTTTGGATCAACTTCTCTTTTTTAAGATATAAAAATGTTGTGATGGTCTTGGCATCCAAGGGAGATCATGCCTTAAATGGTCTATATACAAGAATCAATACAAGACACATATTAGAGACAAGCAAGATGGTTGAAGAATACTCTGGTATGCATTTGCAACCTCACAAGCCTCTTGTTGGTGCTAATGCATTTGTCCATGCAAGTGGCATTCATCAGGATGGAATGCTTAAACATAAA

Predicted protein sequences of Glyma13g12470

Limit To All Plant Sequences

>Glyma13g12470.1   sequence type=predicted peptide   gene model=Glyma13g12470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFKTSVWINFSFLRYKNVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGMHLQPHKPLVGANAFVHASGIHQDGMLKHK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain