SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g12470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g12470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g12470

Feature Type:gene_model
Chromosome:Gm13
Start:16031907
stop:16033325
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18500AT Annotation by Michelle Graham. TAIR10: methylthioalkylmalate synthase-like 4 | chr1:6369347-6372861 FORWARD LENGTH=631 SoyBaseE_val: 4.00E-29ISS
GO:0009098GO-bp Annotation by Michelle Graham. GO Biological Process: leucine biosynthetic process SoyBaseN/AISS
GO:0019752GO-bp Annotation by Michelle Graham. GO Biological Process: carboxylic acid metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003852GO-mf Annotation by Michelle Graham. GO Molecular Function: 2-isopropylmalate synthase activity SoyBaseN/AISS
GO:0046912GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer SoyBaseN/AISS
PTHR10277Panther ISOPROPYLMALATE SYNTHASE RELATED JGI ISS
PTHR10277:SF9Panther 2-ISOPROPYLMALATE SYNTHASE-RELATED JGI ISS
UniRef100_I1LKJ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LKJ2_SOYBN SoyBaseE_val: 7.00E-41ISS
UniRef100_Q39891UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probable 2-isopropylmalate synthase n=1 Tax=Glycine max RepID=LEU1_SOYBN SoyBaseE_val: 6.00E-39ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g12470 not represented in the dataset

Glyma13g12470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g12470.1   sequence type=CDS   gene model=Glyma13g12470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTTTAAAACGAGTGTTTGGATCAACTTCTCTTTTTTAAGATATAAAAATGTTGTGATGGTCTTGGCATCCAAGGGAGATCATGCCTTAAATGGTCTATATACAAGAATCAATACAAGACACATATTAGAGACAAGCAAGATGGTTGAAGAATACTCTGGTATGCATTTGCAACCTCACAAGCCTCTTGTTGGTGCTAATGCATTTGTCCATGCAAGTGGCATTCATCAGGATGGAATGCTTAAACATAAA

>Glyma13g12470.1   sequence type=predicted peptide   gene model=Glyma13g12470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFKTSVWINFSFLRYKNVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGMHLQPHKPLVGANAFVHASGIHQDGMLKHK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo