Report for Sequence Feature Glyma13g12220
Feature Type: gene_model
Chromosome: Gm13
Start: 15674776
stop: 15675018
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g12220
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_C6JS03 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein Sb0016s002040 (Fragment) n=4 Tax=Sorghum bicolor RepID=C6JS03_SORBI
SoyBase E_val: 4.00E-43 ISS
UniRef100_G7K0C9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 likeTBP n=1 Tax=Medicago truncatula RepID=G7K0C9_MEDTR
SoyBase E_val: 2.00E-40 ISS
Expression Patterns of Glyma13g12220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma13g12220 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma13g12220
Coding sequences of Glyma13g12220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g12220.1 sequence type=CDS gene model=Glyma13g12220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TACGGATCCATTTTGCCGACTTCCCTTGCCTACATTGTTCCATCGACCAGAGGCTGTTCACCTTGGAGACCTGATGCGGTTATGAGTACGACCGGGCGTGGGAGGCACTCGGTCCTCCGGATTTTCAAGGGCCGCCGGGGGCGCACCGGACACCACGCGACGTGCGGTGCTCTTCCAGCCGCTGGACCCTACCTCCGGCTGAGCCGTTTCCAGGGTGGGCAGGCTGTTAAACAGAAAAGATAA
Predicted protein sequences of Glyma13g12220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g12220.1 sequence type=predicted peptide gene model=Glyma13g12220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
YGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*