SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g12127

Feature Type:gene_model
Chromosome:Gm13
Start:15604008
stop:15604654
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g12127
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04842AT Annotation by Michelle Graham. TAIR10: threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative | chr2:1698466-1701271 REVERSE LENGTH=650 SoyBaseE_val: 3.00E-29ISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006435GO-bp Annotation by Michelle Graham. GO Biological Process: threonyl-tRNA aminoacylation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004829GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11451Panther TRNA SYNTHETASE-RELATED JGI ISS
UniRef100_D9ZHD6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Threonyl-tRNA synthetase n=1 Tax=Hypericum perforatum RepID=D9ZHD6_HYPPE SoyBaseE_val: 6.00E-28ISS
UniRef100_F6HHK5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=F6HHK5_VITVI SoyBaseE_val: 1.00E-29ISS

Expression Patterns of Glyma13g12127
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g12127 not represented in the dataset
Glyma13g12127 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g12127 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g024000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g12127
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g12127
>Glyma13g12127.1   sequence type=CDS   gene model=Glyma13g12127   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCAATGCAATTTTGTGGTTTACCTTGCAGGCATGCAGAGTGCATGTGATGGCAATGGCTGTTCAAAAGCTTTACCCTGATGCAAAAGTCACAATTGGGCCTTGGATAGAGAATGGGTTTTATTATGACTTCGATACCGAGCCTTTGACTGATAAAGATTTGAAGAGAAGTAAGAAAGAGATGGATCGAATTATTGGAAAAAATTTGCCTGCCACTTGCAAGAGAAGAAGTTTCTAG
Predicted protein sequences of Glyma13g12127
>Glyma13g12127.1   sequence type=predicted peptide   gene model=Glyma13g12127   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCNAILWFTLQACRVHVMAMAVQKLYPDAKVTIGPWIENGFYYDFDTEPLTDKDLKRSKKEMDRIIGKNLPATCKRRSF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo