SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g12114): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g12114): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g12114

Feature Type:gene_model
Chromosome:Gm13
Start:15594337
stop:15604007
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04842AT Annotation by Michelle Graham. TAIR10: threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative | chr2:1698466-1701271 REVERSE LENGTH=650 SoyBaseE_val: 2.00E-134ISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006435GO-bp Annotation by Michelle Graham. GO Biological Process: threonyl-tRNA aminoacylation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004829GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11451Panther TRNA SYNTHETASE-RELATED JGI ISS
PTHR11451:SF5Panther THREONYL-TRNA SYNTHETASE JGI ISS
PF00587PFAM tRNA synthetase class II core domain (G, H, P, S and T) JGI ISS
UniRef100_G7J9I7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Threonyl-tRNA synthetase n=1 Tax=Medicago truncatula RepID=G7J9I7_MEDTR SoyBaseE_val: 1.00E-140ISS
UniRef100_I1NAJ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAJ0_SOYBN SoyBaseE_val: 3.00E-151ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g12114 not represented in the dataset

Glyma13g12114 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g023900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g12114.1   sequence type=CDS   gene model=Glyma13g12114   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCATACAAGTTGGAGATTTTGGAAAGCATTAAGGAGGATCCCATCACCATTTATCACATCGGTGATGAGTGGTGGGACCTCTGTGCTGGAAAGGAAGCCAATGTTGCAACGGATATACGGTACTGCATGGGAGAATGAAGAGCAGTTGAAAGCTTACCTTCACTTCAAAGAGGAAGCCAAGCGTCGAGATCACAGGCGCCTAGGGCAAGATCTTGATTTGTTTTCTATACAGGATGATGCTGGTGGGGGTCTAGTTTTCTGGCACCCAAACGGTGCTATGGTCAGACACATAATTGAAGATTTCTGGAAAAAAATTCACATGAAACGTGGCTATGATCTACTGTACACACCGCATGTGGCAAAAGCTGATCTTTGGAAGATCAGTGGTCATTTGGATTTCTGCAAAGAGAATATGTATGATCAGATGAGCGTTGAGGATGAGCTTCATCAGCTTCGGCCAATGAATTGTCCTTATCATATTTTGGTGTACAAAAGCAAGCTTCATTCCTATCGTGATTTCCCTATCAGGGTAGCAGAATTAGGAACTGTTTATAGATATGAACTATCTGGAAGTTTACATGGCCTTTTCCGTGTTAGAGGTTTCACACAGGATGACGCACATATATTTTGTTTAGATGACCAGATTAAAGATGAGATCAGGGGTGTCCTAGATCTTACTGAAGAAATACTATTACAATTTGGTTTTGAAAAGTACGAAGTAAATTTATCTACAAGGCTGGTTTTGAAAAGTATGAAGTAA

>Glyma13g12114.1   sequence type=predicted peptide   gene model=Glyma13g12114   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNHTSWRFWKALRRIPSPFITSVMSGGTSVLERKPMLQRIYGTAWENEEQLKAYLHFKEEAKRRDHRRLGQDLDLFSIQDDAGGGLVFWHPNGAMVRHIIEDFWKKIHMKRGYDLLYTPHVAKADLWKISGHLDFCKENMYDQMSVEDELHQLRPMNCPYHILVYKSKLHSYRDFPIRVAELGTVYRYELSGSLHGLFRVRGFTQDDAHIFCLDDQIKDEIRGVLDLTEEILLQFGFEKYEVNLSTRLVLKSMK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo