Glyma13g11380 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g11380

Feature Type:	gene_model
Chromosome:	Gm13
Start:	13950661
stop:	13951456
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g11380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G22580	AT	Annotation by Michelle Graham. TAIR10: Stress responsive A/B Barrel Domain \| chr5:7502709-7503137 FORWARD LENGTH=111	SoyBase	E_val: 3.00E-32	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07876	PFAM	Stress responsive A/B Barrel Domain	JGI		ISS
UniRef100_G2XMA3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hypothetical_protein n=1 Tax=Oryza brachyantha RepID=G2XMA3_ORYBR	SoyBase	E_val: 7.00E-21	ISS
UniRef100_I1LXN5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LXN5_SOYBN	SoyBase	E_val: 6.00E-70	ISS

Expression Patterns of Glyma13g11380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g11380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g008100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g11380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g11380

Limit To All Plant Sequences

>Glyma13g11380.1   sequence type=CDS   gene model=Glyma13g11380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGACTTTCAATCACTATGTGATTGTTAAGTTCAACGATGGTGTGGCTGTTGATGAACTCATTCAAGGGTTGGAGAAGATGGTGTCTGGGATTGACCATGTCAAGTCCTTTGAAAGGGGAAAGGACATTGAAAGTCATGATATGCTAAGACAAGGTTTCACTCATGTTTTCTTGATGGCATTCAATGGGAAGGAGGAGTTCAACGCATTTCAAACTCACGTGAATGACCTTGAGTTTACCGGATTATTTTCACCTGCTATTGAGAAGATTGTGGTGTTGGATTTCCCATCTAACCTTATGAAAGCACCAGCATGA

Predicted protein sequences of Glyma13g11380

Limit To All Plant Sequences

>Glyma13g11380.1   sequence type=predicted peptide   gene model=Glyma13g11380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTFNHYVIVKFNDGVAVDELIQGLEKMVSGIDHVKSFERGKDIESHDMLRQGFTHVFLMAFNGKEEFNAFQTHVNDLEFTGLFSPAIEKIVVLDFPSNLMKAPA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain