SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g11370

Feature Type:gene_model
Chromosome:Gm13
Start:13931125
stop:13934481
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g11370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48500AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10930.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:19653235-19654017 FORWARD LENGTH=167 SoyBaseE_val: 3.00E-37ISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1LXN4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LXN4_SOYBN SoyBaseE_val: 2.00E-104ISS
UniRef100_Q9LV64UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD28645.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LV64_ARATH SoyBaseE_val: 9.00E-33ISS

Expression Patterns of Glyma13g11370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g11370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g008000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g11370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g11370
>Glyma13g11370.1   sequence type=CDS   gene model=Glyma13g11370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGTATTACTACCAGAGACATCACGTGCCAGCATTTGGGAGCTGGGATTGGAATGATAATCTTCCTTTTACACAATGCTTTGAGTCTGCAAGACAGGCTGGTTTGCTAAGATATGGTTACTCTGAGTCTGAAGATAGAGATCTTTATGTCACTGGAGACTTGTATGAGAATGATTTTGTCAAACCCGCTGTGATCGTTGTTCCTCGCAGAAGGGAAAAGGTACGTTGCCAGAATGAAAAAGACGAAAAAAAGCAGAATTGGGTGAGTAATGTGAAGGAGCTACCTAGCCCAACTAGTCCAATTCAAAGACCAAAACCAAAGCCGGTGGATGAGGACTTGTACAAGATCTCACCAGAGCTTCTTTATGCCAAAAATAGGAAGAAGAGAGGGTTGTGTTTCTTTCCAAGCTGCTTGATGCCAACTTGCATTGCTTGA
Predicted protein sequences of Glyma13g11370
>Glyma13g11370.1   sequence type=predicted peptide   gene model=Glyma13g11370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEYYYQRHHVPAFGSWDWNDNLPFTQCFESARQAGLLRYGYSESEDRDLYVTGDLYENDFVKPAVIVVPRRREKVRCQNEKDEKKQNWVSNVKELPSPTSPIQRPKPKPVDEDLYKISPELLYAKNRKKRGLCFFPSCLMPTCIA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo