SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g10800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g10800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g10800

Feature Type:gene_model
Chromosome:Gm13
Start:12969459
stop:12973290
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35410AT Annotation by Michelle Graham. TAIR10: Clathrin adaptor complex small chain family protein | chr4:16832572-16833796 FORWARD LENGTH=162 SoyBaseE_val: 7.00E-105ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0030125GO-cc Annotation by Michelle Graham. GO Cellular Compartment: clathrin vesicle coat SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
KOG0934 KOG Clathrin adaptor complex, small subunit JGI ISS
PTHR11753Panther CLATHRIN COAT ASSEMBLY PROTEIN JGI ISS
PF01217PFAM Clathrin adaptor complex small chain JGI ISS
UniRef100_C6SVA2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVA2_SOYBN SoyBaseE_val: 3.00E-113ISS
UniRef100_G7KFD7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Clathrin assembly small subunit protein AP19 n=1 Tax=Medicago truncatula RepID=G7KFD7_MEDTR SoyBaseE_val: 2.00E-107ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g10800 not represented in the dataset

Glyma13g10800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g004600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g10800.1   sequence type=CDS   gene model=Glyma13g10800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAACTTTGTGCTTCTCATTAGTCGCCAAGGGAAGGTGAGACTGACAAAATGGTACTCACCTTATTCTCAGAAAGAAAGGAGTAAGGTAATCCGTGAGCTCAGTGGAATGATTCTTTCCCGTGCTCCCAAGCAATGTAATTTTGTAGAATGGCGAGGACATAAAGTTGTTTATAAAAGGTATGCTAGTCTCTATTTCTGCATGTGCATTGATCAAGATGACAATGAATTAGAAGTCCTTGAAATAATTCATCATTTTGTGGAGATTCTTGACCGGTATTTTGGCAGTGTCTGTGAACTGGACTTAATATTCAACTTTCACAAGGCCTACTATATACTAGATGAAATTCTAATTGCCGGTGAGCTTCAAGAGTCCAGCAAGAAAACAGTTGCTCGATTGATAGCAGCACAGGATTCGTTGGTGGAGAATGCGAAGGAAGAAGTCAGTTCATTAAGTAATATAATTGCACAAGCCACTAAGTGA

>Glyma13g10800.1   sequence type=predicted peptide   gene model=Glyma13g10800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELSGMILSRAPKQCNFVEWRGHKVVYKRYASLYFCMCIDQDDNELEVLEIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGELQESSKKTVARLIAAQDSLVENAKEEVSSLSNIIAQATK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo