Glyma13g10800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g10800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g10800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g10800

Feature Type:	gene_model
Chromosome:	Gm13
Start:	12969459
stop:	12973290
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g10800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G35410	AT	Annotation by Michelle Graham. TAIR10: Clathrin adaptor complex small chain family protein \| chr4:16832572-16833796 FORWARD LENGTH=162	SoyBase	E_val: 7.00E-105	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0030125	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: clathrin vesicle coat	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
KOG0934	KOG	Clathrin adaptor complex, small subunit	JGI		ISS
PTHR11753	Panther	CLATHRIN COAT ASSEMBLY PROTEIN	JGI		ISS
PF01217	PFAM	Clathrin adaptor complex small chain	JGI		ISS
UniRef100_C6SVA2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVA2_SOYBN	SoyBase	E_val: 3.00E-113	ISS
UniRef100_G7KFD7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Clathrin assembly small subunit protein AP19 n=1 Tax=Medicago truncatula RepID=G7KFD7_MEDTR	SoyBase	E_val: 2.00E-107	ISS

Expression Patterns of Glyma13g10800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g10800 not represented in the dataset	Glyma13g10800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g10800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g004600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g10800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g10800

Limit To All Plant Sequences

>Glyma13g10800.1   sequence type=CDS   gene model=Glyma13g10800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAACTTTGTGCTTCTCATTAGTCGCCAAGGGAAGGTGAGACTGACAAAATGGTACTCACCTTATTCTCAGAAAGAAAGGAGTAAGGTAATCCGTGAGCTCAGTGGAATGATTCTTTCCCGTGCTCCCAAGCAATGTAATTTTGTAGAATGGCGAGGACATAAAGTTGTTTATAAAAGGTATGCTAGTCTCTATTTCTGCATGTGCATTGATCAAGATGACAATGAATTAGAAGTCCTTGAAATAATTCATCATTTTGTGGAGATTCTTGACCGGTATTTTGGCAGTGTCTGTGAACTGGACTTAATATTCAACTTTCACAAGGCCTACTATATACTAGATGAAATTCTAATTGCCGGTGAGCTTCAAGAGTCCAGCAAGAAAACAGTTGCTCGATTGATAGCAGCACAGGATTCGTTGGTGGAGAATGCGAAGGAAGAAGTCAGTTCATTAAGTAATATAATTGCACAAGCCACTAAGTGA

Predicted protein sequences of Glyma13g10800

Limit To All Plant Sequences

>Glyma13g10800.1   sequence type=predicted peptide   gene model=Glyma13g10800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELSGMILSRAPKQCNFVEWRGHKVVYKRYASLYFCMCIDQDDNELEVLEIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGELQESSKKTVARLIAAQDSLVENAKEEVSSLSNIIAQATK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain