SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g10780

Feature Type:gene_model
Chromosome:Gm13
Start:12931705
stop:12931974
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g10780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G32270AT Annotation by Michelle Graham. TAIR10: zinc transporter 3 precursor | chr2:13704278-13706612 FORWARD LENGTH=339 SoyBaseE_val: 8.00E-28ISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0006829GO-bp Annotation by Michelle Graham. GO Biological Process: zinc ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0071577GO-bp Annotation by Michelle Graham. GO Biological Process: zinc ion transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005385GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion transmembrane transporter activity SoyBaseN/AISS
GO:0046873GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion transmembrane transporter activity SoyBaseN/AISS
PTHR11040Panther ZINC-IRON TRANSPORTER JGI ISS
PTHR11040:SF1Panther ZINC/IRON TRANSPORTER JGI ISS
PF02535PFAM ZIP Zinc transporter JGI ISS
UniRef100_G7J824UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc transporter n=1 Tax=Medicago truncatula RepID=G7J824_MEDTR SoyBaseE_val: 1.00E-35ISS
UniRef100_I1LXL2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LXL2_SOYBN SoyBaseE_val: 4.00E-56ISS

Expression Patterns of Glyma13g10780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g10780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g10780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g10780
>Glyma13g10780.2   sequence type=CDS   gene model=Glyma13g10780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAAGTGAAATTATTACACGCAAATTTCAAGAGGTTATCTATTACAATAATGGGGTTGTTCTTAGCTTTAACTACTCCAATGGGGATTGGAATTGGCATAGGGATCACTAATGTTTATGATGAAAATAGTCCAACTGCCCTTATTGTGGAAGGAATCTTCAATGCAGCATCGGCTGAGATCTTAATCTACGTGGCACGGATAGATCTTCTTGCAGCAGATTTTAAAAATCCAAGAATGAAAAAAACTGGTAGCCTTCTAATATTTTTTTAA
Predicted protein sequences of Glyma13g10780
>Glyma13g10780.2   sequence type=predicted peptide   gene model=Glyma13g10780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EVKLLHANFKRLSITIMGLFLALTTPMGIGIGIGITNVYDENSPTALIVEGIFNAASAEILIYVARIDLLAADFKNPRMKKTGSLLIFF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo