SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g10771

Feature Type:gene_model
Chromosome:Gm13
Start:12928158
stop:12930129
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g10771
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15140AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 26 Blast hits to 26 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:8639683-8640261 REVERSE LENGTH=165 SoyBaseE_val: 1.00E-18ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SZU2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZU2_SOYBN SoyBaseE_val: 3.00E-119ISS
UniRef100_Q94JV9UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT4g15140/dl3615c n=2 Tax=Arabidopsis thaliana RepID=Q94JV9_ARATH SoyBaseE_val: 5.00E-16ISS

Expression Patterns of Glyma13g10771
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g10771 not represented in the dataset
Glyma13g10771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g10771 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g004200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g10771
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g10771
>Glyma13g10771.1   sequence type=CDS   gene model=Glyma13g10771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGGGGAAAACAATGAAAATCATGTGAATGCAGTTGAAAAATGTTGTTTTGGGGAGAAGACAGACATTACAATTTGCAACGGCTACATTGTTGTGTGTCGTTGTGTCTCTCTCTCTTCCTTTTTTCCTTACACGGCAAATCCAAACCCAACAAAAGCTTTCAAAAGTGTTAGGTGTAAAGAAAGTAAAGAGAGTGAGAGAGAGCAAAAGAAGCAAAGACCAACTAGTGTTAATTTTGCAATGGAATCTCAAACACTATATGAGAAAGAAGAAGAAGCACTAGTGTTGAAAACAACAAAAGTGGTAGAGTATTTGGTGCCAAAGATGTCAATTGAGCTTCTGTGCAAGTTTCCAGACAACTCTGCCTATGACTTTGACTACTCTCAGAGCACAATCTGGTCCCCTTTGCTTCCAAGACCTTACAGTCCTATGGATTTGGATCTTATCACTCCAAAGAAGCTTTCCTATGACATGGGTTTGGGAGCTAAATGCAGTGTCAAGAAGGTGGGTTCTAAGCTTAGGAAGAAGTTCACTGCCTCTGCCTTCAATCTCAACCTTGATTTCATAAAAAAGAATAGCAAGAGTAAGAACAAGAAGTTGCCTTCTGATTTCTCTCCAACACCCTTTAAAGGTGCTTGCAACCCCATCTTGAACAAGCGATGGGCAAGAGCACTGAAAGCTGCCTCAAAACAGTTTAAGAAATGGAAGGTGAAGAGGAGAGACCCCATTGCCCATGTGATGCTACCCAGATTGTGA
Predicted protein sequences of Glyma13g10771
>Glyma13g10771.1   sequence type=predicted peptide   gene model=Glyma13g10771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQGENNENHVNAVEKCCFGEKTDITICNGYIVVCRCVSLSSFFPYTANPNPTKAFKSVRCKESKESEREQKKQRPTSVNFAMESQTLYEKEEEALVLKTTKVVEYLVPKMSIELLCKFPDNSAYDFDYSQSTIWSPLLPRPYSPMDLDLITPKKLSYDMGLGAKCSVKKVGSKLRKKFTASAFNLNLDFIKKNSKSKNKKLPSDFSPTPFKGACNPILNKRWARALKAASKQFKKWKVKRRDPIAHVMLPRL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo