SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g10640

Feature Type:gene_model
Chromosome:Gm13
Start:12608653
stop:12611248
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g10640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42050AT Annotation by Michelle Graham. TAIR10: DCD (Development and Cell Death) domain protein | chr5:16815630-16816932 FORWARD LENGTH=349 SoyBaseE_val: 5.00E-103ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF10539PFAM Development and cell death domain JGI ISS
UniRef100_I1LXK1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LXK1_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q5JZR1UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-rich protein n=1 Tax=Glycine max RepID=Q5JZR1_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma13g10640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g10640
ParalogEvidenceComments
Glyma20g16100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g10640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g003200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g10640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g10640
>Glyma13g10640.1   sequence type=CDS   gene model=Glyma13g10640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAACTACAACAGCAATGACTTTTGGAAATTCAGTGACCAGTTGAGGCTTGAATCTGGTTTGGCCAATCTGTCTCTGAATGATTATTCCATTTGGAGCAACAGCTACAGCTCCAAGAGGCCTGATCAGAGGAGGAACTTTGATGTCAAGGGCAGTGATTTCAACAACTCATCAAAGCCTTTTGATGATGATTTCAATGATGGCTGGAAGATCACCAATTCCAATGGACCCCTTTTCTCTATGCCTCACAACAACAACACTCACACTCTTGAAGTTGGAGGCTTCAACAAGGGAGGAATCTATTCCAACACCAACACCACTTCCTCCTTATATCCTAACCTTAACAACAACACTCTTGGAGGCTTCAACAAGGGAATCTATTCCAACACCACATCCTCACCCTATCTTAACCTTAACAACAACAACAACAACCACCTCAACAACAACCTTAACAGCAATAATCTCAAGGGCTACAAGACATTTTTTAAGGGTGAAGATCAGTTTCACACACCCAAAAGTGCCAAGAAAAACAGCAGCAACAACAACAACAAGAAGCATGGGGACAACACTAACAATAATGAAGCCACCAAGACTGCTGCAGAGAAGAAATTCAAAACACTGCCACCATCAGAGTCTCTGCCTAAGAATGAAACCATTGGAGGCTACATCTTTGTTTGCAACAACGATACCATGGCAGAGAATCTCCAAAGACAGCTCTTTGGTCTGCCTCCACGGTACAGAGATTCAGTTAGAACAATAACTCCAGGGTTGCCCCTTTTTCTGTACAACTACTCCACTCACCAACTCCATGGTATCTTTGAGGCTGCAAGTTTTGGAGGATCTAATATTGATCCAACGGCTTGGGAGGATAAGAAGTGCCCTGGTGAATCTCGTTTCCCTGCTCAGGTTCAAGTGATTACTAGGAAAGTTTGTGAGCCACTAGAGGAAGATTCCTTCAGACCAATTCTTCACCACTACGACGGCCCTAAGTTCCGTCTTGAGCTGAGTGTGCCTGAGGCACTGTCTCTTCTGGATATTTTTGCAAACCAGAACAGTTTCGATGACATTTTCAAAGTCATTCCAGCATAG
Predicted protein sequences of Glyma13g10640
>Glyma13g10640.1   sequence type=predicted peptide   gene model=Glyma13g10640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNYNSNDFWKFSDQLRLESGLANLSLNDYSIWSNSYSSKRPDQRRNFDVKGSDFNNSSKPFDDDFNDGWKITNSNGPLFSMPHNNNTHTLEVGGFNKGGIYSNTNTTSSLYPNLNNNTLGGFNKGIYSNTTSSPYLNLNNNNNNHLNNNLNSNNLKGYKTFFKGEDQFHTPKSAKKNSSNNNNKKHGDNTNNNEATKTAAEKKFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPILHHYDGPKFRLELSVPEALSLLDIFANQNSFDDIFKVIPA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo