Report for Sequence Feature Glyma13g10441
Feature Type: gene_model
Chromosome: Gm13
Start: 12286146
stop: 12287408
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g10441
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI000233B662 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233B662 related cluster n=1 Tax=unknown RepID=UPI000233B662
SoyBase E_val: 2.00E-65 ISS
Expression Patterns of Glyma13g10441
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g10441
Paralog Evidence Comments
Glyma20g16531 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g10441 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g001800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g10441
Coding sequences of Glyma13g10441
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g10441.1 sequence type=CDS gene model=Glyma13g10441 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTGTTGGTCAACACACACACAGTTTGAGTTAGAGTTGGATGGACATGGAATGGTGCCTATAAGAATCAGAGAAAGAGAAAGGATCCACAACATTAGGTTGAAGAGGAAAAAGTTGGAGGACATTCCGGAGGAAACCGAGCTTCCTATTGATACTAATCCAGCAGAGCTTGAAGAAGCGAGCCTTCACTTGGAAACAGATTTGGAAATACTGAGCCGAGCCATGGATATGGGACTTTGGGCACTCTGCCTCGGTTTCGGCTATATCCTTTCCAGAGCTCACTTTCGCCCACTTTCTTGA
Predicted protein sequences of Glyma13g10441
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g10441.1 sequence type=predicted peptide gene model=Glyma13g10441 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MCWSTHTQFELELDGHGMVPIRIRERERIHNIRLKRKKLEDIPEETELPIDTNPAELEEASLHLETDLEILSRAMDMGLWALCLGFGYILSRAHFRPLS*