|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G32990 | AT | Annotation by Michelle Graham. TAIR10: plastid ribosomal protein l11 | chr1:11955827-11957139 FORWARD LENGTH=222 | SoyBase | E_val: 4.00E-74 | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG3257 | KOG | Mitochondrial/chloroplast ribosomal protein L11 | JGI | ISS | |
| PTHR11661 | Panther | 60S RIBOSOMAL PROTEIN L12 | JGI | ISS | |
| PTHR11661:SF4 | Panther | 50S RIBOSOMAL PROTEIN L11 | JGI | ISS | |
| PF00298 | PFAM | Ribosomal protein L11, RNA binding domain | JGI | ISS | |
| PF03946 | PFAM | Ribosomal protein L11, N-terminal domain | JGI | ISS | |
| UniRef100_G7J7D8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L11 n=1 Tax=Medicago truncatula RepID=G7J7D8_MEDTR | SoyBase | E_val: 3.00E-79 | ISS |
| UniRef100_UPI000233B65E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B65E related cluster n=1 Tax=unknown RepID=UPI000233B65E | SoyBase | E_val: 1.00E-118 | ISS |
|
Glyma13g10300 not represented in the dataset |
Glyma13g10300 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.13g000900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g10300.2 sequence type=CDS gene model=Glyma13g10300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCATCTACTCTCTTCGCTTGCCCGTCGTTGTGTTCCTCCTCTTCTTCTATATTTTCTACTTCCGTCAAATTCTCCTTAAACCCGAATAAAATTTCTCTTCCGTTCGCCGGAAACAAAAAACCTCTTTCAGCTCCAATTCGAAGGCGGTTCAATGTCATTGCTATGGCTCCCCCTAAACCCGGTGGGAAGGCCAAGAAAGGATATTTTTTGTTTGGTGTGTGCAGTGGAATTATAAAGCTGACTCTTGAAGCTGGGAAGGCTACACCTGCTCCTCCCGTTGGCCCTGCTCTTGGTTCCAAGGGTGTCAATATTATGGCTTTCTGTAAGGATTACAACGCTAGAACCGCCGACAAGCCCGTTCTACTTCTTAAAGCCGCTGGGGTGGAAAAGGGTTCAAAAGACCCCAAGGCGGAAAAGGTAGGAAAGGTCACGATTGATCAATTGCGTACAAGTGCTGCTGAAAAGCTACCGGACTTGAATTGCTCGAGTATCGAATCAGCTATGAGAATTATAGCGGGCACTGCGGCAAATATGGGGATTGTGGTTGATCCTCCTGTTCTTGAACCCAAACAGAAGGAATTTGTGTAG
>Glyma13g10300.2 sequence type=predicted peptide gene model=Glyma13g10300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASTLFACPSLCSSSSSIFSTSVKFSLNPNKISLPFAGNKKPLSAPIRRRFNVIAMAPPKPGGKAKKGYFLFGVCSGIIKLTLEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPVLLLKAAGVEKGSKDPKAEKVGKVTIDQLRTSAAEKLPDLNCSSIESAMRIIAGTAANMGIVVDPPVLEPKQKEFV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||