SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g10300

Feature Type:gene_model
Chromosome:Gm13
Start:12017914
stop:12020024
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g10300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32990AT Annotation by Michelle Graham. TAIR10: plastid ribosomal protein l11 | chr1:11955827-11957139 FORWARD LENGTH=222 SoyBaseE_val: 4.00E-74ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3257 KOG Mitochondrial/chloroplast ribosomal protein L11 JGI ISS
PTHR11661Panther 60S RIBOSOMAL PROTEIN L12 JGI ISS
PTHR11661:SF4Panther 50S RIBOSOMAL PROTEIN L11 JGI ISS
PF00298PFAM Ribosomal protein L11, RNA binding domain JGI ISS
PF03946PFAM Ribosomal protein L11, N-terminal domain JGI ISS
UniRef100_G7J7D8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L11 n=1 Tax=Medicago truncatula RepID=G7J7D8_MEDTR SoyBaseE_val: 3.00E-79ISS
UniRef100_UPI000233B65EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B65E related cluster n=1 Tax=unknown RepID=UPI000233B65E SoyBaseE_val: 1.00E-118ISS

Expression Patterns of Glyma13g10300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g10300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g000900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g10300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g10300
>Glyma13g10300.2   sequence type=CDS   gene model=Glyma13g10300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCTACTCTCTTCGCTTGCCCGTCGTTGTGTTCCTCCTCTTCTTCTATATTTTCTACTTCCGTCAAATTCTCCTTAAACCCGAATAAAATTTCTCTTCCGTTCGCCGGAAACAAAAAACCTCTTTCAGCTCCAATTCGAAGGCGGTTCAATGTCATTGCTATGGCTCCCCCTAAACCCGGTGGGAAGGCCAAGAAAGGATATTTTTTGTTTGGTGTGTGCAGTGGAATTATAAAGCTGACTCTTGAAGCTGGGAAGGCTACACCTGCTCCTCCCGTTGGCCCTGCTCTTGGTTCCAAGGGTGTCAATATTATGGCTTTCTGTAAGGATTACAACGCTAGAACCGCCGACAAGCCCGTTCTACTTCTTAAAGCCGCTGGGGTGGAAAAGGGTTCAAAAGACCCCAAGGCGGAAAAGGTAGGAAAGGTCACGATTGATCAATTGCGTACAAGTGCTGCTGAAAAGCTACCGGACTTGAATTGCTCGAGTATCGAATCAGCTATGAGAATTATAGCGGGCACTGCGGCAAATATGGGGATTGTGGTTGATCCTCCTGTTCTTGAACCCAAACAGAAGGAATTTGTGTAG
Predicted protein sequences of Glyma13g10300
>Glyma13g10300.2   sequence type=predicted peptide   gene model=Glyma13g10300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTLFACPSLCSSSSSIFSTSVKFSLNPNKISLPFAGNKKPLSAPIRRRFNVIAMAPPKPGGKAKKGYFLFGVCSGIIKLTLEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPVLLLKAAGVEKGSKDPKAEKVGKVTIDQLRTSAAEKLPDLNCSSIESAMRIIAGTAANMGIVVDPPVLEPKQKEFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo