SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g10130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g10130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g10130

Feature Type:gene_model
Chromosome:Gm13
Start:11702770
stop:11708703
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21720AT Annotation by Michelle Graham. TAIR10: proteasome beta subunit C1 | chr1:7626394-7628070 FORWARD LENGTH=204 SoyBaseE_val: 2.00E-144ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051603GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005839GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex SoyBaseN/AISS
GO:0004175GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity SoyBaseN/AISS
GO:0004298GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG0180 KOG 20S proteasome, regulatory subunit beta type PSMB3/PUP3 JGI ISS
PTHR11599Panther PROTEASOME SUBUNIT ALPHA/BETA JGI ISS
PTHR11599:SF7Panther PROTEASOME BETA SUBUNIT JGI ISS
PF00227PFAM Proteasome subunit JGI ISS
UniRef100_C6SV91UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=C6SV91_SOYBN SoyBaseE_val: 4.00E-149ISS
UniRef100_C6SV91UniRef Annotation by Michelle Graham. Best UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=C6SV91_SOYBN SoyBaseE_val: 4.00E-149ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g10130 not represented in the dataset

Glyma13g10130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g24270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g031200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g10130.1   sequence type=CDS   gene model=Glyma13g10130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGATCTTCGAGTACAACGGAAGCGCCGTGGTGGCTATGGTCGGCAAGAACTGCTTCGCCATTGCCAGCGACCGAAGGCTCGGCGTTCAGCTCCAAACCATAGCCACGGATTTCCAACGCATTTCCAAGATTCACGACAAGCTCTTCATCGCTCTCTCTGGCCTCGCCACCGATGCTCAAACATTGTATCAGCGTCTTGTTTTCCGGCACAAACTGTATCAGCTTCGTGAAGAGAGGGATATGAAACCAGAGACCTTTGCCAGCTTAGTCTCTGCTCTGCTTTATGAGAAAAGGTTTGGTCCATACTTTTGTCAGCCTGTAATTGCTGGATTAGGGGATGAAGACAAACCATTCATCTGCACAATGGATTGTCTTGGGGCAAAGGAGCTTGCAAAAGATTTTGTTGTTTCTGGGACTGCATCTGAGTCTCTGTATGGTGCTTGTGAGGCGATGTTTAAGCCTGACATGGAACCAGAGGAATTGTTTGAGACCATCTCCCAAGCACTGCTATCATCTGTAGATCGTGATTGTTTGAGTGGCTGGGGAGGACATGTCTATGTTGTCACGCCAACCGAAGTGAAGGAAAGGATTTTGAAGGGAAGGATGGATTAA

>Glyma13g10130.1   sequence type=predicted peptide   gene model=Glyma13g10130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIALSGLATDAQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFICTMDCLGAKELAKDFVVSGTASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLSGWGGHVYVVTPTEVKERILKGRMD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo