Glyma13g10110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g10110

Feature Type:	gene_model
Chromosome:	Gm13
Start:	11686063
stop:	11686470
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g10110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G34885	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF784) \| chr5:13201546-13201893 FORWARD LENGTH=115	SoyBase	E_val: 3.00E-12	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
PF05617	PFAM	Protein of unknown function (DUF784)	JGI		ISS
UniRef100_A8MQF4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein n=1 Tax=Arabidopsis thaliana RepID=A8MQF4_ARATH	SoyBase	E_val: 3.00E-08	ISS
UniRef100_I1LXG4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LXG4_SOYBN	SoyBase	E_val: 3.00E-82	ISS

Expression Patterns of Glyma13g10110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g10110

Paralog	Evidence	Comments
Glyma14g24300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g10110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g031400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g10110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g10110

Limit To All Plant Sequences

>Glyma13g10110.2   sequence type=CDS   gene model=Glyma13g10110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACATTCAGCAACATTTCTCTAATGGTCCTATGTTTCATTATTAGTTCTTCCTTGATGGTCAAAATCGGGCTTTCACAAGATGCTCCGGAACCATCAAATGCACCAGGGCCAATGTCATCGTATGTCAAGTATTTAGCCAATTGTGGGTCTCATTTGTCCCCAAATTGTGGTGATGAGGTATTCTCAGCAATATTTTTTGGTAACAAAACAGTTAGTAATGGTTGTTGTGACAAGCTTGTGAATGATGTTGGGAAAGTGTGCCACGATGATATGACAAAGTATATTTTGACATTGCCTAAGTTCCGGGCCCATAAAATTCAGATCTTGAAGAGGAGTGAGAAGGTTTGGTTTGATTGTGATTTGCAGGACTACCCTTTTGGACCCGATGGTCCTGAATCATGA

Predicted protein sequences of Glyma13g10110

Limit To All Plant Sequences

>Glyma13g10110.2   sequence type=predicted peptide   gene model=Glyma13g10110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATFSNISLMVLCFIISSSLMVKIGLSQDAPEPSNAPGPMSSYVKYLANCGSHLSPNCGDEVFSAIFFGNKTVSNGCCDKLVNDVGKVCHDDMTKYILTLPKFRAHKIQILKRSEKVWFDCDLQDYPFGPDGPES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain