SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g09675

Feature Type:gene_model
Chromosome:Gm13
Start:11235026
stop:11235807
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09675
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24050AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr4:12497287-12499661 FORWARD LENGTH=332 SoyBaseE_val: 3.00E-49ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR24320Panther FAMILY NOT NAMED JGI ISS
PTHR24320:SF98Panther JGI ISS
UniRef100_B9RYQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Short-chain dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RYQ7_RICCO SoyBaseE_val: 2.00E-48ISS
UniRef100_UPI0002337DC0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337DC0 related cluster n=1 Tax=unknown RepID=UPI0002337DC0 SoyBaseE_val: 2.00E-55ISS

Expression Patterns of Glyma13g09675
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09675 not represented in the dataset
Glyma13g09675 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09675 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g034000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09675
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09675
>Glyma13g09675.1   sequence type=CDS   gene model=Glyma13g09675   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGCCAACGTCACTGTGAATTGTGTTCATCCTGGGATCGTTAGAACCAGACTCACTAGAGAGCGTGAGGGCTTACTCACAGATTTGGTGTTCTTTTTGGCTTCCAAGCTCTTGAAGACCATTCCTCAGGCAGCTGCTACGACATGTTATGTGGCCACTCATCCAAGGCTTTTCAATGTCTCCGACAAGTACTTTGCTGACTGTAACGAAATTTCAACCTCAAAATTGGGATCTAACTCAACTGAAGCTGCAAGGTTATGGGCTGCAAGTCTAAAATATAATTGCTTTAGATGCTAG
Predicted protein sequences of Glyma13g09675
>Glyma13g09675.1   sequence type=predicted peptide   gene model=Glyma13g09675   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGANVTVNCVHPGIVRTRLTREREGLLTDLVFFLASKLLKTIPQAAATTCYVATHPRLFNVSDKYFADCNEISTSKLGSNSTEAARLWAASLKYNCFRC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo