SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g09301

Feature Type:gene_model
Chromosome:Gm13
Start:10430404
stop:10430931
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09301
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G42140AT Annotation by Michelle Graham. TAIR10: zinc ion binding;nucleic acid binding | chr3:14302060-14303018 REVERSE LENGTH=273 SoyBaseE_val: 1.00E-12ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_I1LXB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LXB6_SOYBN SoyBaseE_val: 2.00E-75ISS
UniRef100_Q7G3D9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Retrotransposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q7G3D9_ORYSJ SoyBaseE_val: 2.00E-17ISS

Expression Patterns of Glyma13g09301
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09301 not represented in the dataset
Glyma13g09301 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09301 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g036500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09301
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09301
>Glyma13g09301.1   sequence type=CDS   gene model=Glyma13g09301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAATATATGGAAGCCTCTTAAAGGAGTTACCATTTCATATATTGGCAATGGAACTTTCCTATTCCGGTTCTACCATCAAGTTGACATTCAAAGAGTTCTAAAAGGAGGGTCATGGAGGTTTGACAGATACATGCTAATTCTGGGAGTGATTACGGAGGACGAGAATCCTTTAGAGATACCGTTGTTCAACGTGCCTTTTTGGGTCCAAATTCATAATTTGCCTTTGGGATTCATGTCAAAAAGGGTAGGGCAGAATATCGGCAACTACTTAGGCAAATTCCTAGAATATGATGAGAAGAACTTTATAAATTTCTGCATCCATTTATGTAAGCCTGGAGGTGATCCAAAGGAAGTCTTCTTCAAATTTGAAAGACCTGGCACGTTTTGCTATTTATGTGGCTTGATTAGTCATATTGGTGAACATTGTGAGAAGCTTCTTCTGATTGGTGAAGTCAATGGAATTAGA
Predicted protein sequences of Glyma13g09301
>Glyma13g09301.1   sequence type=predicted peptide   gene model=Glyma13g09301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANIWKPLKGVTISYIGNGTFLFRFYHQVDIQRVLKGGSWRFDRYMLILGVITEDENPLEIPLFNVPFWVQIHNLPLGFMSKRVGQNIGNYLGKFLEYDEKNFINFCIHLCKPGGDPKEVFFKFERPGTFCYLCGLISHIGEHCEKLLLIGEVNGIR






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo