SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g09250

Feature Type:gene_model
Chromosome:Gm13
Start:10354504
stop:10355283
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10370AT Annotation by Michelle Graham. TAIR10: helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related | chr5:3261245-3267188 FORWARD LENGTH=1775 SoyBaseE_val: 7.00E-88ISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR18934Panther ATP-DEPENDENT RNA HELICASE JGI ISS
PF04408PFAM Helicase associated domain (HA2) JGI ISS
UniRef100_G7J375UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA splicing factor ATP-dependent RNA helicase-like protein n=1 Tax=Medicago truncatula RepID=G7J375_MEDTR SoyBaseE_val: 1.00E-95ISS
UniRef100_I1MYP1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MYP1_SOYBN SoyBaseE_val: 1.00E-121ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g036900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g09250.1   sequence type=CDS   gene model=Glyma13g09250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCTAAATCAAGAGTCGGAGATTCGGAGAGTTCATCTTGGTGTAGCAGTTCTGAGGATCCTTGCTTTAGGAGTGAAAGATGTGCTAGGTTTTGATTTTGTGGATGCTCCAAGTCCTAGCTCCATAGATATGGCAATCAAAAATCTAATTCAATTACGAGCCATTGAACTCAACTATGATGTTCATGATTTAACTTCTGAAGGTTGGTGCTTGGTAAGAATGGGAATTGAACCTAGGCTGGGTAAACTTATTCTTGGTTGTTTCAAACATGGTTTGGGTAAGGAAGGTATCATCCTTGCTACTGTGATGGCCAATGCTAGTAGCATCTTTTGCAGAGTTGGCAGTGAATTTGATAAACAAAGATTTGATGGTCTTAAAGTGCAATTTTGCCATTGTGATGGTGACCTCTTTACTCTTCTCTCTGTGTACAAGGAATGGGAAGCTTTGCCTCGAGAAAGGAAGAACAAATGGTGTTGGGAAAACAATATCAATGCCAAATCCATGAGGAGTTACTGGCGTTGGGACACTTGTATGCCTTCTAATCATGATAAGAATTTGAAAAGGGTAATACTGTCCTCACCTGCTGAGAATGTAGCCATGTACTCCGGCTGCTTCATTGAAGTGAATGTTGACAATAATGAAATCCACTTATATGCCTCTTCAAATTATATGGATATAGCCCTTGGGTTGGTTAATGATGTTCTAGAATAA

>Glyma13g09250.1   sequence type=predicted peptide   gene model=Glyma13g09250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLNQESEIRRVHLGVAVLRILALGVKDVLGFDFVDAPSPSSIDMAIKNLIQLRAIELNYDVHDLTSEGWCLVRMGIEPRLGKLILGCFKHGLGKEGIILATVMANASSIFCRVGSEFDKQRFDGLKVQFCHCDGDLFTLLSVYKEWEALPRERKNKWCWENNINAKSMRSYWRWDTCMPSNHDKNLKRVILSSPAENVAMYSGCFIEVNVDNNEIHLYASSNYMDIALGLVNDVLE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo