SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g09185): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g09185): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g09185

Feature Type:gene_model
Chromosome:Gm13
Start:10203911
stop:10205794
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09185
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49310AT Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein | chr3:18285084-18287991 REVERSE LENGTH=460 SoyBaseE_val: 1.00E-68ISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
PTHR24063Panther FAMILY NOT NAMED JGI ISS
PTHR24063:SF159Panther JGI ISS
PF05631PFAM Protein of unknown function (DUF791) JGI ISS
UniRef100_G7J860UniRef Annotation by Michelle Graham. Most informative UniRef hit: Major facilitator superfamily domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J860_MEDTR SoyBaseE_val: 2.00E-67ISS
UniRef100_UPI000233AF8FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AF8F related cluster n=1 Tax=unknown RepID=UPI000233AF8F SoyBaseE_val: 2.00E-79ISS

Expression Patterns of Glyma13g09185
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09185 not represented in the dataset
Glyma13g09185 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09185 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g037400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09185
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09185
>Glyma13g09185.1   sequence type=CDS   gene model=Glyma13g09185   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCATCAATTTATTAGGAAGAGGTCGGAAGAGGGCTTGTGTGACTTACTGCATAACCTACATTTTGAGTTGCATCACCAAGCATTCTCCTCAATACAAAGTCCTGATGTTGGGCCGCATTTTGGGAGGTATTGCCACTTCACTTCTGTTTTCATCATTTGAATCATGGCTTGTTGCTGAGCACTTCAAGAGGGGCTTTGATCAACAATGGTTGTCATTAACATTCTCTAAGGCTATATTTCTTGGAAATGGTCTTGTTGCTATTTTGTCTGGGCTGTTTGGAAATGTACTTGTTGATACATTGGCTCTTGGACTTGTGGCCCCCTTTGATGCTGCTTCATGTTTTCTTGCTATTGGTGTGGCCATTGCTTTGGGTAGATTTCTTACCTTAAAATTTATTTTTCTCATTTTAATACTGCAAATTTGA
Predicted protein sequences of Glyma13g09185
>Glyma13g09185.1   sequence type=predicted peptide   gene model=Glyma13g09185   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLINLLGRGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVAEHFKRGFDQQWLSLTFSKAIFLGNGLVAILSGLFGNVLVDTLALGLVAPFDAASCFLAIGVAIALGRFLTLKFIFLILILQI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo