SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g09106

Feature Type:gene_model
Chromosome:Gm13
Start:10096326
stop:10096759
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09106
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09740AT Annotation by Michelle Graham. TAIR10: histone acetyltransferase of the MYST family 2 | chr5:3022141-3024711 REVERSE LENGTH=367 SoyBaseE_val: 2.00E-32ISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004402GO-mf Annotation by Michelle Graham. GO Molecular Function: histone acetyltransferase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR10615Panther MYST-RELATED PROTEINS JGI ISS
PF01853PFAM MOZ/SAS family JGI ISS
UniRef100_B7ZXU9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Zea mays RepID=B7ZXU9_MAIZE SoyBaseE_val: 3.00E-30ISS
UniRef100_F4KE11UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYST-like histone acetyltransferase 2 n=1 Tax=Arabidopsis thaliana RepID=F4KE11_ARATH SoyBaseE_val: 1.00E-29ISS

Expression Patterns of Glyma13g09106
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09106 not represented in the dataset
Glyma13g09106 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09106 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g038000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09106
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09106
>Glyma13g09106.1   sequence type=CDS   gene model=Glyma13g09106   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCGTGCCACATGGACTTGGTCCAATGAGGGAAGCCGCTATCATTTTTGTAATACAACAATACAAGGCTATGGAAAATTTCTAATTGCATTCTCATATGAACTGGAAAAAAAGGAGGGCAAAGTTGGCACACCTGAAAGACCCCTTTCAGACCTTGGACTGCTAAGCTACAGAGGATATTGGACCAGGGTTCTCTTAGACATTCTGAATAAGCACAAGGGAAACATTTCTATCAAGGTACCATATTCTTTTCTATTAATGTTTCTAAGACACAGAAGAATTCATCTATTCTGTTTACAAATAAAGTTCATTTGA
Predicted protein sequences of Glyma13g09106
>Glyma13g09106.1   sequence type=predicted peptide   gene model=Glyma13g09106   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRATWTWSNEGSRYHFCNTTIQGYGKFLIAFSYELEKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILNKHKGNISIKVPYSFLLMFLRHRRIHLFCLQIKFI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo