SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g09083

Feature Type:gene_model
Chromosome:Gm13
Start:10088284
stop:10094317
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09083
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01530AT Annotation by Michelle Graham. TAIR10: myb domain protein 57 | chr3:210352-211151 REVERSE LENGTH=206 SoyBaseE_val: 2.00E-39ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0080086GO-bp Annotation by Michelle Graham. GO Biological Process: stamen filament development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_G7ICT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Myb-like transcription factor n=1 Tax=Medicago truncatula RepID=G7ICT7_MEDTR SoyBaseE_val: 1.00E-42ISS
UniRef100_UPI000233AF8BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AF8B related cluster n=1 Tax=unknown RepID=UPI000233AF8B SoyBaseE_val: 2.00E-87ISS

Expression Patterns of Glyma13g09083
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09083 not represented in the dataset
Glyma13g09083 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09083 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g038100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09083
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09083
>Glyma13g09083.1   sequence type=CDS   gene model=Glyma13g09083   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTTAAGAAAGGTGGGTCTTTAGTACAAATGCAAGTGAAGTTGCAGAAGCATAACGAAAAGGAGATGGGCATGAGAAAAGGTCCATGGGCGGTTGGCGAGGACACCATTCTGTTCAATTACATCGCCACACACGGTGGAGGTCACTGGAATTCTGTGGCAAGATGTGCAGGTCTAAGGAGGAGTGGGAAGAGTTATAGATTAAGGTGGCTAAACTACTTGCGCCCCGACGTGTGGCATGGAAATGTCACACTCCAAGAACAAATATTAATTCTCGACTTTCACTGTCGCAGGGGCAACATGTATGGTGGTCAAACATGTCAACAGCTGCTAGGAAGAACAGACAACAAAATAAAGAACTATTGGAGAATTGAGTGA
Predicted protein sequences of Glyma13g09083
>Glyma13g09083.1   sequence type=predicted peptide   gene model=Glyma13g09083   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVKKGGSLVQMQVKLQKHNEKEMGMRKGPWAVGEDTILFNYIATHGGGHWNSVARCAGLRRSGKSYRLRWLNYLRPDVWHGNVTLQEQILILDFHCRRGNMYGGQTCQQLLGRTDNKIKNYWRIE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo