SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g09026

Feature Type:gene_model
Chromosome:Gm13
Start:10024366
stop:10027213
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g09026
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77110AT Annotation by Michelle Graham. TAIR10: Auxin efflux carrier family protein | chr1:28970855-28974408 FORWARD LENGTH=570 SoyBaseE_val: 1.00E-58ISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0048451GO-bp Annotation by Michelle Graham. GO Biological Process: petal formation SoyBaseN/AISS
GO:0048453GO-bp Annotation by Michelle Graham. GO Biological Process: sepal formation SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0009672GO-mf Annotation by Michelle Graham. GO Molecular Function: auxin:hydrogen symporter activity SoyBaseN/AISS
PF03547PFAM Membrane transport protein JGI ISS
UniRef100_E5KGD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin efflux facilitator SlPIN6 n=1 Tax=Solanum lycopersicum RepID=E5KGD8_SOLLC SoyBaseE_val: 4.00E-64ISS
UniRef100_UPI000233AF88UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AF88 related cluster n=1 Tax=unknown RepID=UPI000233AF88 SoyBaseE_val: 6.00E-79ISS

Expression Patterns of Glyma13g09026
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g09026 not represented in the dataset
Glyma13g09026 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g09026 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g038400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g09026
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g09026
>Glyma13g09026.1   sequence type=CDS   gene model=Glyma13g09026   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAATGCCTAGTCTTATCAAAGCATCGGTCAAAATCATCTCAGATGCGGGCCTTGGGATGGCTATGTTTAGCTTAGGGCTTTTCATGGCCCTTCAGCCTCGTATCATAGCTTGCGGTACCAAAAGAGCAGTCATGGGCATGGTCATTCGCTTCATGTGTGGGCCTCTTGTAATGTCTGCTTCTTCAATTGTCATTGGATTAAGACAAGACAGACTTCACACTGCCATTGTACAGGCTGCTCTTCCACAGGGGATAGTGCCATTTATATTTGCAAGGGAATATGGATTGCATCCTGATATTTTGAGCACAGGGGTTATCTTTGGCATGTTAATATCCTTACCAATAACTCTCTTATATTACATATTTCTTGGCTTATGA
Predicted protein sequences of Glyma13g09026
>Glyma13g09026.1   sequence type=predicted peptide   gene model=Glyma13g09026   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEMPSLIKASVKIISDAGLGMAMFSLGLFMALQPRIIACGTKRAVMGMVIRFMCGPLVMSASSIVIGLRQDRLHTAIVQAALPQGIVPFIFAREYGLHPDILSTGVIFGMLISLPITLLYYIFLGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo