SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g08880

Feature Type:gene_model
Chromosome:Gm13
Start:9627580
stop:9628447
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g08880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30810AT Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein | chr2:13127945-13128630 REVERSE LENGTH=106 SoyBaseE_val: 1.00E-26ISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_G7K6W8UniRef Annotation by Michelle Graham. Most informative UniRef hit: GAST1 n=1 Tax=Medicago truncatula RepID=G7K6W8_MEDTR SoyBaseE_val: 1.00E-38ISS
UniRef100_I1LX92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LX92_SOYBN SoyBaseE_val: 2.00E-61ISS

Expression Patterns of Glyma13g08880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g08880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g039600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g08880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g08880
>Glyma13g08880.1   sequence type=CDS   gene model=Glyma13g08880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTAAAGTTGTGTGTGCACTTCTTCTTATTTTTGTCATGGCTTTTGTGACTCAAGTTGCTTATGGTGGCGGCGAAGGATCACTTACGCCCCAAGAATGTCCGGGGGCTTGCGATTATCGTTGTTCAAAGGCTGATCGGACTAAGAAGGCGTGCCTGAACTTCTGTAACATGTGCTGTGCGAAATGTCTGTGCGTTCCATCAGGAACCTATGGTCACAAGGAAGAATGTCCATGTTATAACAATTGGAAAACAAAGAGAGGAACTCCCAAGTGCCCCTAA
Predicted protein sequences of Glyma13g08880
>Glyma13g08880.1   sequence type=predicted peptide   gene model=Glyma13g08880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTKVVCALLLIFVMAFVTQVAYGGGEGSLTPQECPGACDYRCSKADRTKKACLNFCNMCCAKCLCVPSGTYGHKEECPCYNNWKTKRGTPKCP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo