SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g08480

Feature Type:gene_model
Chromosome:Gm13
Start:8953481
stop:8957215
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g08480
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53300AT Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 10 | chr5:21632802-21633989 REVERSE LENGTH=148 SoyBaseE_val: 7.00E-104ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
GO:0031625GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin protein ligase binding SoyBaseN/AISS
KOG0417 KOG Ubiquitin-protein ligase JGI ISS
PTHR24068Panther FAMILY NOT NAMED JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_I1LX80UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LX80_SOYBN SoyBaseE_val: 2.00E-106ISS
UniRef100_J3UE53UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating enzyme n=1 Tax=Lycoris longituba RepID=J3UE53_9ASPA SoyBaseE_val: 3.00E-102ISS

Expression Patterns of Glyma13g08480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g08480 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g040500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g08480
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g08480
>Glyma13g08480.1   sequence type=CDS   gene model=Glyma13g08480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCGAAGCGAATTTTGAAGGAGCTTAAGGATTTGCAGAAGGATCCTCCAACATCTTGCAGTGCCGGTCCTGTTGTTGCTGAAGATATGTTCCATTGGCAAGCTACAATTATGGGTCCTCCAGACAGTCCCTATGCAGGAGGTGTTTTCCTAGTGACCATTCATTTCCCTCCAGATTATCCCTTTAAGCCACCCAAGGTTGCATTCAGGACAAAGGTTTTCCACCCAAATATAAATAGCAATGGAAGCATTTGCCTTGATATATTGAAGGAGCAGTGGAGCCCTGCTCTAACCATTTCCAAGGTGTTGCTCTCAATTTGTTCCCTATTGACGGATCCAAATCCTGATGATCCTTTGGTCCCTGAAATTGCACACATGTACAAGACAGATAGGAACAAGTACGAGTCAAATGCAAGAAGCTGGACCCAGAAATATGCCATGGGCTAA
Predicted protein sequences of Glyma13g08480
>Glyma13g08480.1   sequence type=predicted peptide   gene model=Glyma13g08480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKRILKELKDLQKDPPTSCSAGPVVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYESNARSWTQKYAMG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo