Glyma13g08400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g08400

Feature Type:	gene_model
Chromosome:	Gm13
Start:	8719318
stop:	8723499
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g08400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46330	AT	Annotation by Michelle Graham. TAIR10: arabinogalactan protein 16 \| chr2:19018730-19019108 REVERSE LENGTH=73	SoyBase	E_val: 2.00E-15	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
PF06376	PFAM	Protein of unknown function (DUF1070)	JGI		ISS
UniRef100_G7J699	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Arabinogalactan peptide n=1 Tax=Medicago truncatula RepID=G7J699_MEDTR	SoyBase	E_val: 5.00E-20	ISS
UniRef100_I1LX76	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LX76_SOYBN	SoyBase	E_val: 1.00E-32	ISS

Expression Patterns of Glyma13g08400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g08400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g041100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g08400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g08400

Limit To All Plant Sequences

>Glyma13g08400.1   sequence type=CDS   gene model=Glyma13g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTTTCCAAGGTGGTTGTTTTTCTTGGTCTGATTCTCGCCGCCCTTATGTCAGTGGCTTGCTCCCAATCCGCTGCTCCGGCTCCTGCTCCTGCTCCCACAAGCGATGGCACCTCAATTGACCAAGCTGTAGCGTATGTTCTAATGTTGGTTGCCTTGGTTCTAACTTACATCATGCATTAA

Predicted protein sequences of Glyma13g08400

Limit To All Plant Sequences

>Glyma13g08400.1   sequence type=predicted peptide   gene model=Glyma13g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVSKVVVFLGLILAALMSVACSQSAAPAPAPAPTSDGTSIDQAVAYVLMLVALVLTYIMH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain